Rv0009 - iron-regulated peptidyl-prolyl-cis-trans-isomerase A ppiA

Expression: Most Significant Conditions for Rv0009

Protein Domains

Gene Information
Locus	Rv0009
Symbol	ppiA
Gene Name	iron-regulated peptidyl-prolyl-cis-trans-isomerase A ppiA
Location	12468 - 13016 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:549 bp Protein:183 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35349
Related Genes	CE0029 cg0048 DIP0025 jk0033 MAP0011 MAV_0013 Mkms_0018 ML0011 Mmcs_0010 MSMEG_0024 MT0011 MUL_0013 Mvan_0017 nfa38520
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0009
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0009 Transcript 1
MADCDSVTNSPLATATATLHTNRGDIKIALFGNHAPKTVANFVGLAQGTKDYSTQNASGG
PSGPFYDGAVFHRVIQGFMIQGGDPTGTGRGGPGYKFADEFHPELQFDKPYLLAMANAGP
GTNGSQFFITVGKTPHLNRRHTIFGEVIDAESQRVVEAISKTATDGNDRPTDPVVIESIT
IS*

Genomic Sequence

>Rv0009
ATGGCAGACTGTGATTCCGTGACTAACAGCCCCCTTGCGACCGCTACCGCCACGCTGCAC
ACTAACCGCGGCGACATCAAGATCGCCCTGTTCGGAAACCATGCGCCCAAGACCGTCGCC
AATTTTGTGGGCCTTGCGCAGGGCACCAAGGACTATTCGACCCAAAACGCATCAGGTGGC
CCGTCCGGCCCGTTCTACGACGGCGCGGTCTTTCACCGGGTGATCCAGGGCTTCATGATC
CAGGGTGGCGATCCAACCGGGACGGGTCGCGGCGGACCCGGCTACAAGTTCGCCGACGAG
TTCCACCCCGAGCTGCAATTCGACAAGCCCTATCTGCTCGCGATGGCCAACGCCGGTCCG
GGCACCAACGGCTCACAGTTTTTCATCACCGTCGGCAAGACTCCGCACCTGAACCGGCGC
CACACCATTTTCGGTGAAGTGATCGACGCGGAGTCACAGCGGGTTGTGGAGGCGATCTCC
AAGACGGCCACCGACGGCAACGATCGGCCGACGGACCCGGTGGTGATCGAGTCGATCACC
ATCTCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006