Rv0047c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0047c

Protein Domains

Gene Information
Locus	Rv0047c
Symbol
Gene Name	conserved hypothetical protein
Location	51185 - 51727 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:543 bp Protein:181 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29701
Related Genes	Acel_2137 MAP0061c MAV_0068 Mkms_5464 ML2691 Mmcs_5375 MSMEG_6903 MT0053 MUL_0065 Mvan_6039 nfa55530 SAV4295
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0047c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0047c Transcript 1
MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADGLIAENAAPAG
TPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFFNRTPAEARMRILEGRR
RQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWLNELIAAERAAPNPAEQT
*

Genomic Sequence

>Rv0047c
ATGCTGGAGCTCGCCATCCTGGGTCTGTTGATCGAGTCACCGATGCATGGCTACGAGTTG
CGCAAGAGGCTGACCGGCCTGCTGGGCGCGTTTCGGGCATTTTCGTACGGTTCGTTATAC
CCGGCGCTGCGACGCATGCAGGCCGACGGGTTGATCGCCGAGAATGCCGCCCCAGCGGGC
ACCCCGGTGCGGCGAGCACGACGCGTTTACCAACTGACCGACAAGGGTCGCCGTCGATTC
GGCGAGCTGGTGGCCGACACCGGCCCACACAACTACACCGACGACGGTTTCGGGGTGCAC
CTGGCGTTCTTCAACCGCACCCCGGCCGAAGCGCGGATGCGCATCCTGGAAGGCCGGCGC
CGCCAGGTCGAGGAACGCCGGGAAGGCTTGCGCGAGGCGGTGGCGCGGGCCAGCAGTTCC
TTCGACCGCTACACCCGCCAATTGCATCAACTCGGGCTCGAGTCCAGCGAGCGCGAGGTC
AAGTGGCTCAACGAGCTCATCGCCGCGGAACGGGCAGCACCCAACCCCGCCGAACAGACG
TAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Structural Analysis F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Structural Analysis N. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Spectrophotometric F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Spectrophotometric N. Scherr, S. Honnappa et al. Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Structural Analysis authors,J. Gury,L. Barthelmebs,NP. Tran,C. Diviès,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Interaction	Operon Rv0046c	active	priti.priety	2012-10-05
	Structural Analysis authors,J. Gury,L. Barthelmebs,NP. Tran,C. Diviès,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Structural Analysis F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0046c	active	priti.priety	2012-10-05
	Structural Analysis F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Spectrophotometric authors,J. Gury,L. Barthelmebs,NP. Tran,C. Diviès,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Interaction	Operon Rv0046c	active	priti.priety	2012-10-05
	Spectrophotometric authors,J. Gury,L. Barthelmebs,NP. Tran,C. Diviès,JF. Cavin Cloning, deletion, and characterization of PadR, the transcriptional repressor of the phenolic acid decarboxylase-encoding padA gene of Lactobacillus plantarum. Appl. Environ. Microbiol. 2004
Interaction	Operon Rv0048c	active	priti.priety	2012-10-05
	Spectrophotometric F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	Operon Rv0046c	active	priti.priety	2012-10-05
	Spectrophotometric F. Movahedzadeh, DA. Smith et al. The Mycobacterium tuberculosis ino1 gene is essential for growth and virulence. Mol. Microbiol. 2004
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006