Rv0073 - glutamine-transport ATP-binding protein ABC transporter

Expression: Most Significant Conditions for Rv0073

Protein Domains

Gene Information
Locus	Rv0073
Symbol
Gene Name	glutamine-transport ATP-binding protein ABC transporter
Location	81676 - 82668 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:993 bp Protein:331 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35766
Related Genes	Mkms_5031 Mmcs_4943 MSMEG_6309 MT0079 Mvan_5577
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0073
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0073 Transcript 1
MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCGKTTLLSCLGGILRPK
SGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVENVMVPLRSAGMSRRAS
RRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPPLILADEPTAHLDFIQVE
EVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAETNRPPETVHLQAGEVLFEQ
STMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEIGVLFHLPRSATVRARSDAT
AVGYTVQAFRERLGVGGLRDLIEHRALAND*

Genomic Sequence

>Rv0073
GTGGGCGATCTCAGCATTCAGAACCTCGTCGTTGAGTACTACAGCGGTGGATACGCGCTT
AGGCCGATCAACGGTTTGAACCTCGACGTGGCAGCCGGGTCGTTGGTGATGCTGCTCGGA
CCCAGCGGCTGCGGCAAGACGACACTGCTTTCCTGTCTGGGCGGCATTCTGCGCCCGAAG
TCTGGGGCGATCAAGTTCGACGAAGTCGACATCACGACGCTACAAGGCGCCGAGCTGGCG
AACTACCGGCGTAACAAGGTCGGCATCGTGTTCCAGGCGTTCAATCTGGTGCCCAGCCTG
ACCGCTGTCGAGAACGTGATGGTGCCGTTACGCTCGGCCGGGATGTCACGCAGGGCGTCG
CGTAGGCGTGCCGAAGAACTGCTGGCGCGCGTCAATCTCGCGGAACGAATGAATCATCGA
CCCGGTGATCTGAGCGGAGGTCAGCAGCAACGAGTCGCGGTGGCACGCGCGATTGCGCTG
GATCCGCCACTGATCCTCGCTGACGAACCGACCGCACACCTGGATTTCATCCAGGTGGAG
GAGGTGCTGCGGTTGATCCGCGAACTGGCCGATGGCGAGCGTGTGGTCGTGGTCGCAACC
CACGACAGCAGGATGTTGCCGATGGCCGATCGCGTCGTTGAGCTGACACCCGATTTCGCG
GAGACAAATCGGCCACCTGAAACCGTACATCTTCAGGCCGGCGAGGTGCTGTTCGAGCAG
AGCACGATGGGCGACCTGATCTACGTGGTGTCGGAGGGCGAGTTTGAGATTGTGCACGAA
TTGGCCGACGGCGGTGAGGAATTGGTCAAGGTTGCCGGGCCGGGGGATTACTTCGGCGAG
ATAGGCGTGCTGTTTCACCTGCCGCGCTCGGCGACCGTGCGTGCCCGCAGCGACGCGACG
GCCGTCGGCTATACCGTGCAGGCGTTTCGTGAGCGGCTCGGCGTGGGGGGTCTGCGCGAT
CTGATCGAGCATCGTGCGCTTGCCAACGACTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006