Rv0096 - PPE family protein

Expression: Most Significant Conditions for Rv0096

Protein Domains

Gene Information
Locus	Rv0096
Symbol	PPE1
Gene Name	PPE family protein
Location	105324 - 106715 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1392 bp Protein:464 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12681
Related Genes	ML1991 MT0105 MUL_4853
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0096
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0096 Transcript 1
MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQLLGEVQASSWQGTAAT
QYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTPAELAANHAIHGVLIAT
NFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVPSTQPAPPIRAPGGDAAD
TRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTVVLALVALQLYDFLWYPYY
ASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAALGPGDQWGANLAVAVTPAT
AAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLAPPGVSSGPKAGTKSPDTAAD
TLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATATVDAATDVPAPANAAGSQGAG
TLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWTTDAEQ*

Genomic Sequence

>Rv0096
ATGGCTATACCACCGGAGGTGCACTCGGGCCTGTTGAGCGCCGGGTGCGGTCCGGGATCA
TTGCTTGTTGCCGCGCAGCAGTGGCAAGAACTTAGTGATCAGTACGCACTCGCATGCGCC
GAGTTGGGCCAATTGTTGGGCGAGGTTCAGGCCAGCAGCTGGCAGGGAACCGCCGCCACC
CAGTACGTGGCTGCCCATGGCCCCTATCTGGCCTGGCTTGAGCAAACCGCGATCAACAGC
GCCGTCACCGCCGCACAGCACGTAGCGGCTGCCGCTGCCTACTGCAGCGCCCTGGCCGCG
ATGCCCACCCCAGCAGAGCTGGCCGCCAACCACGCCATTCATGGCGTTCTGATCGCCACC
AACTTCTTCGGGATCAACACCGTTCCGATCGCGCTCAACGAAGCCGATTATGTCCGCATG
TGGCTGCAAGCCGCCGACACCATGGCCGCCTACCAGGCCGTCGCCGATGCGGCCACGGTG
GCCGTACCGTCCACCCAACCGGCGCCACCGATCCGCGCGCCCGGCGGCGATGCCGCAGAT
ACCCGGCTAGACGTATTGAGTTCAATTGGTCAGCTCATCCGGGATATCTTGGATTTCATT
GCCAACCCGTACAAGTATTTTCTGGAGTTTTTCGAGCAATTCGGCTTCAGCCCGGCCGTA
ACGGTCGTCCTTGCCCTTGTTGCCCTGCAGCTGTACGACTTTCTTTGGTATCCCTATTAC
GCCTCGTACGGCCTGCTCCTGCTTCCGTTCTTCACTCCCACCTTGAGCGCGTTGACCGCC
CTAAGCGCGCTGATCCATTTGCTGAACCTGCCCCCGGCTGGACTGCTTCCTATCGCCGCA
GCGCTCGGTCCCGGCGACCAATGGGGCGCAAACTTGGCTGTGGCTGTCACGCCGGCCACG
GCGGCCGTGCCCGGCGGAAGCCCGCCCACCAGCAACCCCGCGCCCGCCGCTCCCAGCTCG
AACTCGGTTGGCAGCGCTTCGGCTGCACCCGGCATCAGCTATGCCGTGCCCGGCCTGGCG
CCACCCGGGGTTAGCTCTGGCCCTAAAGCCGGCACCAAATCACCTGACACCGCCGCCGAC
ACCCTTGCAACCGCGGGCGCAGCACGACCGGGCCTCGCCCGAGCCCACCGAAGAAAGCGC
AGCGAAAGCGGCGTCGGGATACGCGGTTACCGCGACGAATTTTTGGACGCGACCGCCACG
GTGGACGCCGCTACGGATGTGCCCGCTCCCGCCAACGCGGCTGGCAGTCAAGGTGCCGGC
ACTCTCGGCTTTGCCGGTACCGCACCGACAACCAGCGGCGCCGCGGCCGGAATGGTTCAA
CTGTCGTCGCACAGCACAAGCACTACAGTCCCGTTGCTGCCCACTACCTGGACAACCGAC
GCCGAACAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv0102	active	gaurisd10	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv3911	active	ashwinigbhat	2012-10-05
	Microarray Analysis S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Transcription Rv0102	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0101	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0100	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0099	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0098	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Transcription Rv0097	active	ashwinigbhat	2012-10-05
	Coexpression T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0491	active	ashwinigbhat	2012-10-05
	Microarray Analysis T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	Regulatory Rv2069	active	gaurisd10	2012-10-05
	ChIP (Physical Interaction) F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv2069	active	gaurisd10	2012-10-05
	ChIP (Physical Interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003