Rv0168 - hypothetical membrane protein yrbE1B

Expression: Most Significant Conditions for Rv0168

Protein Domains

Gene Information
Locus	Rv0168
Symbol	yrbE1B
Gene Name	hypothetical membrane protein yrbE1B
Location	197660 - 198529 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:870 bp Protein:290 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26541
Related Genes	MAP3603 MAV_5016 Mkms_0126 ML2588 Mmcs_0117 MSMEG_0133 MUL_1061 Mvan_0133 nfa29770
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0168
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0168 Transcript 1
MSTAAVLRARFPRAVANLRQYGGAAARGLDEAGQLTWFALTSIGQIAHALRYYRKETLRL
IAQIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIGVEAFTGFFAALINVRI
AGPVVTGVALAATVGAGATAELGAMRISEEIDALEVMGIKSISFLASTRIMAGLVVIIPL
YALAMIMSFLSPQITTTVLYGQSNGTYEHYFQTFLRPDDVFWSFLEALIITAIVMVSHCY
YGYAAGGGPVGVGEAVGRSMRFSLVSVQVVVLFAALALYGVDPNFNLTV*

Genomic Sequence

>Rv0168
ATGTCGACCGCTGCTGTGCTGCGCGCCCGCTTCCCGCGGGCGGTCGCCAACCTTCGTCAA
TATGGAGGTGCGGCGGCCCGTGGATTGGACGAGGCCGGCCAGCTCACCTGGTTCGCTTTG
ACCAGCATCGGGCAGATCGCGCACGCGCTGCGCTACTACCGCAAGGAGACGCTGCGGCTG
ATCGCCCAGATCGGCATGGGTACCGGCGCGATGGCCGTCGTCGGCGGCACGGTCGCCATC
GTTGGCTTTGTCACGCTGTCCGGCAGCTCGCTGGTCGCAATCCAGGGCTTCGCGTCGCTG
GGCAACATCGGTGTCGAGGCGTTCACCGGGTTCTTCGCCGCACTGATCAACGTGCGCATC
GCCGGCCCAGTTGTCACGGGTGTCGCCCTGGCGGCCACGGTCGGTGCGGGTGCTACGGCC
GAGCTGGGCGCGATGCGGATCAGCGAGGAGATCGATGCCCTGGAAGTGATGGGCATCAAG
TCGATCTCGTTTCTGGCCTCCACCCGGATCATGGCCGGGCTGGTGGTGATCATCCCGCTG
TACGCGTTGGCGATGATTATGTCGTTCCTGTCCCCGCAGATCACCACCACGGTGCTCTAC
GGGCAGTCGAACGGCACCTACGAGCATTACTTTCAAACGTTCCTGCGTCCCGACGATGTC
TTTTGGTCCTTCTTGGAGGCCCTCATCATCACTGCGATCGTCATGGTCAGCCACTGCTAC
TACGGGTACGCCGCCGGTGGAGGCCCCGTCGGTGTCGGCGAGGCCGTCGGCCGATCGATG
CGTTTCTCGTTGGTCTCGGTGCAGGTCGTTGTCCTGTTTGCAGCGTTGGCGCTCTACGGT
GTCGACCCGAACTTCAATCTCACGGTGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0655	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SM. Joshi,AK. Pandey,N. Capite,SM. Fortune,EJ. Rubin,CM. Sassetti Characterization of mycobacterial virulence genes through genetic interaction mapping. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0165c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0170	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0169	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0166	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0165c	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009