Rv0170 - MCE-family protein mce1B

Expression: Most Significant Conditions for Rv0170

Protein Domains

Gene Information
Locus	Rv0170
Symbol	mce1B
Gene Name	MCE-family protein mce1B
Location	199895 - 200935 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1041 bp Protein:347 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22138
Related Genes	MAP3605 MAV_5014 Mkms_0128 ML2590 Mmcs_0119 MSMEG_0135 MT0179 MUL_1063 Mvan_0135
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0170
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0170 Transcript 1
MKITGTVVKLGIVSVVLLFFTVMIIVIFGQMRFDRTNGYTAEFSNVSGLRQGQFVRASGV
EIGKVKALHLVDGGRRVRVEFNIDRSVPLYQSTTAQIRYSDLIGNRYVELKRGEGKGAND
LLPPGGLIPLSRTSPALDLDALIGGFKPVFRALDPAKVNNIANALITVFQGQGGTINDIL
DQTAQLTSQIAERDQAIGEVVKNLNIVLDTTVKHRKEFDETVNNLENLITGLRNHSDQLA
GGLAHISNGAGTVADLLAENRTLVRKAVSYLDAIQQPVIDQRVELDDLLHKTPTALTALG
RANGTYGDFQNFYLCDLQIKWNGFQAGGPVRTVKLFSQPTGRCTPQ*

Genomic Sequence

>Rv0170
ATGAAAATCACTGGAACCGTCGTCAAACTCGGCATCGTCTCGGTGGTGCTGCTGTTCTTC
ACGGTGATGATCATCGTGATTTTCGGTCAGATGCGCTTCGACCGGACTAATGGCTATACC
GCGGAGTTCAGCAATGTCAGCGGGCTGCGCCAAGGCCAGTTTGTCCGTGCTTCGGGGGTA
GAGATCGGCAAGGTCAAAGCACTACACCTGGTCGACGGTGGCCGTCGGGTTCGGGTGGAG
TTCAATATCGATCGTTCGGTGCCGTTGTATCAGTCCACGACCGCCCAGATCCGCTATTCC
GACCTGATCGGTAACCGGTACGTGGAGCTCAAACGGGGTGAGGGCAAGGGGGCCAACGAT
CTGCTGCCGCCAGGTGGACTCATCCCATTGTCCCGCACGTCACCGGCCTTGGATCTGGAC
GCGTTGATCGGTGGTTTCAAGCCGGTGTTTCGGGCGTTGGATCCCGCGAAGGTGAACAAC
ATCGCCAACGCGCTCATCACCGTCTTCCAGGGGCAAGGTGGCACCATAAACGACATCCTC
GACCAGACCGCGCAACTGACCAGCCAGATCGCGGAGCGCGATCAGGCGATCGGTGAGGTT
GTCAAGAACCTGAACATCGTGCTGGACACCACGGTCAAGCATCGAAAAGAGTTCGACGAG
ACGGTCAATAACTTGGAGAATCTGATCACTGGGCTGAGGAACCACTCCGACCAGTTGGCC
GGCGGCCTCGCGCACATCAGCAACGGCGCCGGCACGGTGGCCGACCTGCTTGCCGAGAAT
CGCACGTTGGTGCGCAAGGCCGTCAGCTACCTGGACGCTATTCAGCAACCGGTCATCGAC
CAGCGCGTCGAGTTGGACGACCTGCTCCACAAGACGCCGACCGCGTTGACGGCGCTCGGA
CGCGCCAACGGAACCTACGGCGATTTCCAGAACTTCTACCTCTGCGACCTCCAGATCAAG
TGGAACGGATTCCAAGCCGGAGGGCCGGTCCGCACGGTGAAGCTCTTTAGCCAGCCGACG
GGTAGGTGCACGCCGCAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Demonstration of expression of six proteins of the mammalian cell entry (mce1) operon of Mycobacterium tuberculosis by anti-peptide antibodies, enzyme-linked immunosorbent assay and reverse transcription-polymerase chain reaction. Scand. J. Immunol. 1999
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) M. Harboe, A. Christensen et al. Cross-reaction between mammalian cell entry (Mce) proteins of Mycobacterium tuberculosis. Scand. J. Immunol. 2002
Interaction	Regulatory Rv0172	active	shahanup86	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0165c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0174	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0173	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0172	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0171	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0169	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0166	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0168	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0167	active	yashabhasin	2012-10-05
	Operon (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	Regulatory Rv0165c	active	yashabhasin	2012-10-05
	Co-expression (Functional linkage) N. Casali, AM. White et al. Regulation of the Mycobacterium tuberculosis mce1 operon. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006