Rv0234c - succinate-semialdehyde dehydrogenase dependent gabD1

Expression: Most Significant Conditions for Rv0234c

Protein Domains

Gene Information
Locus	Rv0234c
Symbol	gabD1
Gene Name	succinate-semialdehyde dehydrogenase dependent gabD1
Location	279605 - 281140 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1536 bp Protein:512 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37231
Related Genes	Acel_1956 MAP3673c MAV_4936 ML2573 MSMEG_6452 MSMEG_6702 MT0245 MUL_1153 Mvan_1844 SAV7134
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0234c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0234c Transcript 1
MRSVTCSATLVLPVIEPTPADRRPRHLLLGSAGHVSGRLDTGRFVQTHPAKDVSVPIATI
NPATGETVKTFTAATDDEVDAAIARAHRRFADYRQTSFAQRARWANATADLLEAEADQAA
AMMTLEMGKTLAAAKAEALKCAKGFRYYAENAEALLADEPADAAKVGASAAYGRYQPLGV
ILAVMPWNFPLWQAVRFAAPALMAGNVGLLKHASNVPQCALYLADVIARGGFPDGCFQTL
LVSSGAVEAILRDPRVAAATLTGSEPAGQSVGAIAGNEIKPTVLELGGSDPFIVMPSADL
DAAVSTAVTGRVQNNGQSCIAAKRFIVHADIYDDFVDKFVARMAALRVGDPTDPDTDVGP
LATEQGRNEVAKQVEDAAAAGAVIRCGGKRLDRPGWFYPPTVITDISKDMALYTEEVFGP
VASVFRAANIDEAVEIANATTFGLGSNAWTRDETEQRRFIDDIVAGQVFINGMTVSYPEL
PFGGVKRSGYGRELSAHGIREFCNIKTVWIA*

Genomic Sequence

>Rv0234c
ATGCGATCGGTGACATGTTCCGCCACGCTGGTCCTGCCCGTGATAGAGCCCACCCCAGCC
GATAGGAGGCCCCGACACCTCCTGCTCGGGAGCGCTGGCCACGTTAGTGGCAGGCTGGAC
ACCGGACGATTTGTGCAAACCCACCCAGCAAAGGATGTCAGCGTGCCCATCGCCACCATC
AACCCGGCTACCGGCGAAACAGTCAAGACATTCACTGCGGCGACCGATGACGAAGTCGAC
GCGGCAATAGCCCGGGCCCACCGGCGGTTCGCCGACTACCGCCAGACCAGCTTCGCCCAG
CGCGCCCGGTGGGCCAATGCCACCGCCGACTTGCTGGAAGCCGAGGCCGACCAGGCCGCC
GCGATGATGACGCTCGAGATGGGCAAGACGCTGGCCGCGGCCAAAGCCGAGGCACTGAAG
TGCGCCAAGGGTTTTCGCTACTACGCCGAAAACGCCGAGGCGTTGCTGGCCGACGAACCC
GCCGATGCGGCCAAGGTCGGGGCGTCGGCGGCCTACGGCCGATACCAGCCGCTCGGGGTG
ATCCTGGCGGTGATGCCATGGAACTTCCCCCTGTGGCAAGCGGTTCGGTTCGCCGCACCG
GCACTGATGGCCGGAAACGTCGGCCTGCTCAAGCACGCGTCGAACGTGCCGCAATGCGCG
CTGTACCTGGCCGACGTCATCGCCCGAGGCGGCTTCCCGGACGGCTGCTTCCAGACGTTG
CTTGTTAGCTCGGGAGCCGTCGAAGCCATCCTGCGTGATCCCCGGGTCGCGGCGGCCACG
CTGACCGGAAGCGAGCCGGCCGGCCAATCGGTGGGCGCTATCGCCGGTAACGAGATCAAG
CCGACCGTGCTCGAGCTCGGCGGCAGCGACCCGTTCATCGTTATGCCGTCGGCCGATCTG
GACGCCGCGGTCAGCACCGCCGTCACCGGCCGGGTGCAGAACAACGGCCAATCCTGCATC
GCCGCCAAGCGGTTCATCGTCCACGCCGACATTTACGACGATTTCGTCGACAAGTTCGTC
GCGCGGATGGCGGCGTTACGGGTCGGCGACCCGACCGACCCGGACACCGACGTGGGCCCG
CTGGCCACCGAGCAGGGCCGCAACGAGGTTGCCAAGCAAGTCGAGGATGCTGCCGCGGCG
GGCGCGGTGATCCGGTGCGGCGGAAAGCGTCTCGACCGGCCGGGCTGGTTCTACCCGCCG
ACCGTGATCACCGACATCTCCAAGGACATGGCTCTCTACACCGAGGAGGTCTTCGGTCCG
GTCGCCTCGGTGTTCCGCGCGGCGAACATCGACGAGGCCGTCGAGATCGCCAACGCCACC
ACCTTCGGGCTGGGATCCAACGCCTGGACCCGCGACGAGACCGAGCAACGACGCTTCATC
GACGACATCGTGGCGGGCCAGGTTTTTATCAACGGCATGACGGTGTCCTATCCCGAATTG
CCGTTCGGCGGGGTCAAGCGCTCGGGCTATGGCCGGGAACTGTCCGCACACGGGATACGC
GAGTTCTGCAACATCAAGACCGTCTGGATCGCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction	RegulatedBy Rv1963c	active	yamir.moreno	2012-10-05
	Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008
Other	EC:1.2.1.79	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Other	EC:1.2.1.79	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011