Rv0253 - nitrite reductase small subunit nirD

Expression: Most Significant Conditions for Rv0253

Protein Domains

Gene Information
Locus	Rv0253
Symbol	nirD
Gene Name	nitrite reductase small subunit nirD
Location	305453 - 305809 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:357 bp Protein:119 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3893
Related Genes	Acel_1743 MAP3703 MAV_4903 Mkms_0269 Mmcs_0259 MSMEG_0428 MUL_1180 Mvan_0298 nfa45600 SAV5660
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0253
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0253 Transcript 1
MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSVHAVGNVDPFSGAAVM
SRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPARVTPEGRIQVARVAV*

Genomic Sequence

>Rv0253
GTGACGCTTCTCAACGACATTCAGGTATGGACCACCGCCTGCGCATACGACCATCTCATT
CCGGGACGTGGTGTCGGGGTGTTACTCGATGACGGTAGTCAGGTGGCACTGTTCCGGCTC
GACGACGGCTCGGTGCACGCGGTCGGTAACGTCGACCCGTTCTCCGGTGCTGCGGTGATG
TCCCGCGGCATCGTCGGTGATCGCGGAGGTCGCGCCATGGTGCAATCGCCGATCCTGAAG
CAGGCTTTCGCGCTCGACGATGGCTCGTGCCTCGACGATCCGCGCGTTTCGGTGCCGGTG
TATCCGGCGCGCGTCACACCCGAAGGCCGCATTCAGGTCGCGCGGGTAGCGGTCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv0252	active	ashwinigbhat	2012-10-05
	operon S. Malm, Y. Tiffert et al. The roles of the nitrate reductase NarGHJI, the nitrite reductase NirBD and the response regulator GlnR in nitrate assimilation of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Operon Rv0252	active	priti.priety	2012-10-05
	operon S. Malm, Y. Tiffert et al. The roles of the nitrate reductase NarGHJI, the nitrite reductase NirBD and the response regulator GlnR in nitrate assimilation of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Operon Rv0252	active	ashwinigbhat	2012-10-05
	operon authors,J. Amon,F. Titgemeyer,A. Burkovski A genomic view on nitrogen metabolism and nitrogen control in mycobacteria. J. Mol. Microbiol. Biotechnol. 2009
Interaction	Operon Rv0252	active	ashwinigbhat	2012-10-05
	operon S. Malm, Y. Tiffert et al. The roles of the nitrate reductase NarGHJI, the nitrite reductase NirBD and the response regulator GlnR in nitrate assimilation of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	Operon Rv0252	active	priti.priety	2012-10-05
	operon authors,J. Amon,F. Titgemeyer,A. Burkovski A genomic view on nitrogen metabolism and nitrogen control in mycobacteria. J. Mol. Microbiol. Biotechnol. 2009
Interaction	Operon Rv0252	active	priti.priety	2012-10-05
	operon S. Malm, Y. Tiffert et al. The roles of the nitrate reductase NarGHJI, the nitrite reductase NirBD and the response regulator GlnR in nitrate assimilation of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
Interaction	RegulatedBy Rv1785c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1785c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006