Rv0298 - hypothetical protein

Expression: Most Significant Conditions for Rv0298

Protein Domains

Gene Information
Locus	Rv0298
Symbol
Gene Name	hypothetical protein
Location	363252 - 363479 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:228 bp Protein:76 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6997
Related Genes	MT0312
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0298
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0298 Transcript 1
MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVALRDYTAKTVPALDID
AYAQRVYQANRAAGS*

Genomic Sequence

>Rv0298
ATGACGAAAGAGAAGATCTCCGTGACGGTGGACGCGGCCGTCCTCGCGGCGATCGACGCG
GACGCCAGGGCGGCGGGTTTGAATCGGTCGGAAATGATTGAGCAGGCACTGCGCAACGAG
CACCTGCGTGTCGCTCTGCGCGATTACACGGCTAAAACCGTACCGGCGTTGGACATCGAT
GCCTACGCACAGCGGGTGTACCAGGCGAACCGGGCGGCCGGAAGTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv0299	active	sourish10	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	InhibitedBy Rv0299	active	sourish10	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0299	active	ahal4789	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	InhibitedBy Rv0299	active	ahal4789	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0299	active	sourish10	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	InhibitedBy Rv0299	active	sourish10	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0299	active	ahal4789	2012-10-05
	authors,J. Jang,J. Becq,B. Gicquel,P. Deschavanne,O. Neyrolles Horizontally acquired genomic islands in the tubercle bacilli. Trends Microbiol. 2008
Interaction	InhibitedBy Rv0299	active	ahal4789	2012-10-05
	authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009