Rv0300 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0300

Protein Domains

Gene Information
Locus	Rv0300
Symbol
Gene Name	conserved hypothetical protein
Location	363826 - 364047 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:222 bp Protein:74 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6879
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0300
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0300 Transcript 1
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVA
GLGDPELMRQAWR*

Genomic Sequence

>Rv0300
ATGAGTGATGTACTGATTCGGGACATCCCCGACGACGTGTTAGCAAGCCTTGACGCGATC
GCGGCACGCTTGGGCTTGTCGCGGACCGAATACATCCGTCGGCGTTTAGCCCAGGATGCG
CAGACGGCTCGCGTCACCGTGACAGCCGCGGATCTTCGACGCCTCAGGGGTGCGGTTGCC
GGTCTGGGCGATCCCGAGCTTATGCGTCAGGCGTGGAGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0301	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0301	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0301	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv0301	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0301	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0301	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv0301	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0301	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0301	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv0301	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Regulatory Rv0301	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0301	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapB2	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY4C12_4 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (75 aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38 aa overlap)
Other	stop:364047	active	rslayden	2012-03-05
	MTCY4C12_4 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (75 aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38 aa overlap)
Other	start:363826	active	rslayden	2012-03-05
	MTCY4C12_4 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (75 aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38 aa overlap)
Symbol	Vap BC-2	active	rslayden	2012-03-05
	MTCY4C12_4 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (75 aa), FASTA scores: opt: 84, E(): 8.3, (39.5% identity in 38 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Z81360
Other	stop:364047	active	rslayden	2012-03-05
	Z81360
Other	start:363826	active	rslayden	2012-03-05
	Z81360
Symbol	Vap BC-2	active	rslayden	2012-03-05
	Z81360
Other	strand:+	active	rslayden	2012-03-05
	MTCY04C12.06c
Other	stop:364047	active	rslayden	2012-03-05
	MTCY04C12.06c
Other	start:363826	active	rslayden	2012-03-05
	MTCY04C12.06c
Symbol	Vap BC-2	active	rslayden	2012-03-05
	MTCY04C12.06c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1721c
Other	stop:364047	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1721c
Other	start:363826	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1721c
Symbol	Vap BC-2	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1721c