Rv0353 - merR-family heat shock protein transcriptional repressor hspR

Expression: Most Significant Conditions for Rv0353

Protein Domains

Gene Information
Locus	Rv0353
Symbol	hspR
Gene Name	merR-family heat shock protein transcriptional repressor hspR
Location	423639 - 424019 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:381 bp Protein:127 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33432
Related Genes	Acel_2118 BL0516 CE2626 cg3097 DIP2117 jk0184 MAP3843 MAV_4805 Mkms_0476 ML2493 Mmcs_0465 MSMEG_0713 MT0368 MUL_0596 Mvan_0637 nfa54060 PPA2037 SAV4487
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0353
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0353 Transcript 1
MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRYSLHDVELLRQ
VQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRANQRREVAVVPKSTALV
VWKPRR*

Genomic Sequence

>Rv0353
ATGGCGAAGAACCCAAAGGACGGGGAATCCCGGACGTTTTTGATCTCGGTAGCCGCCGAG
CTAGCCGGCATGCATGCACAGACCCTGCGTACCTACGATCGTCTTGGGTTGGTCAGCCCG
CGGCGCACCTCCGGTGGCGGGCGCCGCTATTCCCTGCATGACGTCGAGTTGCTGCGCCAG
GTGCAGCACCTCTCGCAGGACGAGGGGGTCAACTTGGCCGGCATCAAGCGCATTATTGAA
CTGACCAGTCAGGTCGAGGCGCTGCAGTCCAGGTTGCAAGAGATGGCTGAGGAGTTGGCG
GTGTTGCGTGCCAACCAGCGCCGCGAGGTCGCGGTGGTGCCGAAGAGCACCGCCCTGGTC
GTCTGGAAACCGCGCCGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2374c	active	chirupolo	2012-10-05
	Co Expression (Functional linkage) GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	PhysicalInteraction Rv2288	active	hibeeluck	2012-10-05
	Co-occurance (Functional Linkage) GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	Regulatory Rv0350	active	dimpi.srcp	2012-10-05
	Band Shift authors,I. Smith Mycobacterium tuberculosis pathogenesis and molecular determinants of virulence. Clin. Microbiol. Rev. 2003
Interaction	Regulatory Rv0350	active	dimpi.srcp	2012-10-05
	Band Shift T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv0350	active	shahanup86	2012-10-05
	Co occurance (Functional Linkage) authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Complementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. Arch. Microbiol. 2004
Interaction	Signaling Rv0350	active	shahanup86	2012-10-05
	Co occurance (Functional Linkage) T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv0350	active	shahanup86	2012-10-05
	Co occurance (Functional Linkage) TB. Hickey, LM. Thorson et al. Mycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. Infect. Immun. 2009
Interaction	Signaling Rv0350	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional Linkage) authors,MA. Zmijewski,JM. Kwiatkowska,B. LipiDska Complementation studies of the DnaK-DnaJ-GrpE chaperone machineries from Vibrio harveyi and Escherichia coli, both in vivo and in vitro. Arch. Microbiol. 2004
Interaction	Signaling Rv0350	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional Linkage) T. Das Gupta, B. Bandyopadhyay et al. Modulation of DNA-binding activity of Mycobacterium tuberculosis HspR by chaperones. Microbiology (Reading, Engl.) 2008
Interaction	Signaling Rv0350	active	shahanup86	2012-10-05
	Gene Neighborhood (Functional Linkage) TB. Hickey, LM. Thorson et al. Mycobacterium tuberculosis Cpn60.2 and DnaK are Located on the Bacterial Surface, where Cpn60.2 Facilitates Efficient Bacterial Association with Macrophages. Infect. Immun. 2009
Interaction	Regulatory Rv0268c	active	darhngu	2012-10-05
	Co-expression (Functional linkage) GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	Inhibition Rv0250c	active	hibeeluck	2012-10-05
	authors,M. Berney,GM. Cook Unique flexibility in energy metabolism allows mycobacteria to combat starvation and hypoxia. PLoS ONE 2010
Interaction	Inhibition Rv0250c	active	hibeeluck	2012-10-05
	PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	Inhibition Rv0250c	active	hibeeluck	2012-10-05
	authors,K. Kurihashi Letter: Fine cotton thread method of lacrimation. Lancet 1976
Interaction	Transcription Rv0250c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv0250c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	Regulatory Rv0004	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) GR. Stewart, L. Wernisch et al. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Microbiology (Reading, Engl.) 2002
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2034	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0385	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0384c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0350	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0252	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0251c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008