Rv0411c - glutamine-binding lipoprotein glnH

Expression: Most Significant Conditions for Rv0411c

Protein Domains

Gene Information
Locus	Rv0411c
Symbol	glnH
Gene Name	glutamine-binding lipoprotein glnH
Location	497314 - 498300 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:987 bp Protein:329 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36210
Related Genes	CE2588 cg3045 DIP2052 jk0253 MAP3894c MAV_4750 Mkms_0553 ML0303 Mmcs_0541 MSMEG_0787 MT0424 MUL_2809 Mvan_0704 nfa53430
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0411c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0411c Transcript 1
MTRRALLARAAAPLAPLALAMVLASCGHSETLGVEATPTLPLPTPVGMEIMPPQPPLPPD
SSSQDCDPTASLRPFATKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFDV
DIAGEVARDIFGVPSHVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYL
DANQRILAPRDSPITKVSDLSGKRVCVARGTTSLRRIREIAPPPVIVSVVNWADCLVALQ
QREIDAVSTDDTILAGLVEEDPYLHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRN
DGTWNTLYRKWLTVLGPAPAPPTPRYVD*

Genomic Sequence

>Rv0411c
ATGACGCGCCGGGCCCTCCTGGCGCGGGCGGCAGCCCCACTCGCGCCGCTGGCCTTGGCG
ATGGTGCTGGCCAGTTGCGGCCACTCGGAAACGCTGGGGGTGGAGGCGACGCCGACGCTG
CCGCTGCCCACACCGGTCGGCATGGAGATCATGCCACCGCAACCCCCGCTGCCGCCGGAC
AGTTCGAGCCAGGACTGCGATCCCACCGCCAGCCTGCGCCCCTTTGCCACCAAGGCCGAG
GCCGACGCCGCGGTGGCCGACATCCGCGCGCGCGGCAGGCTGATCGTCGGACTCGACATC
GGCAGCAACCTGTTCAGCTTCCGCGACCCGATCACCGGCGAGATCACCGGCTTCGACGTT
GACATCGCCGGCGAAGTGGCACGCGACATCTTCGGTGTCCCGTCACATGTCGAGTACCGG
ATCCTGTCGGCCGCGGAGCGGGTCACCGCGCTGCAGAAGTCGCAGGTCGACATCGTCGTC
AAGACGATGTCGATCACCTGCGAGCGGCGCAAGCTGGTCAACTTCTCCACCGTCTACCTC
GACGCCAACCAACGCATCCTCGCCCCGCGTGACTCGCCGATCACAAAGGTGTCCGACCTG
TCGGGCAAGCGGGTCTGTGTGGCCAGGGGCACCACATCGTTGCGCCGTATCCGGGAGATC
GCACCGCCTCCCGTCATTGTGTCGGTGGTGAACTGGGCGGACTGCTTGGTGGCCTTGCAG
CAGCGCGAGATCGACGCTGTCAGCACCGACGACACCATCCTGGCCGGGCTGGTAGAGGAA
GACCCCTACCTGCATATCGTCGGGCCCGACATGGCCGACCAGCCCTACGGCGTCGGGATC
AACCTGGACAACACCGGATTGGTCCGGTTCGTCAACGGCACGCTCGAACGCATCCGCAAT
GACGGCACCTGGAACACGTTGTATCGCAAGTGGCTGACGGTGCTCGGCCCAGCCCCCGCC
CCGCCCACGCCGAGGTATGTGGACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2564	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null