Rv0463 - conserved membrane protein

Expression: Most Significant Conditions for Rv0463

Protein Domains

Gene Information
Locus	Rv0463
Symbol
Gene Name	conserved membrane protein
Location	554016 - 554309 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:294 bp Protein:98 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6353
Related Genes	MAP3957 MAV_4686 Mkms_0645 ML2388 Mmcs_0632 MSMEG_0904 MT0479 MUL_2215 Mvan_0795
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0463
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0463 Transcript 1
MTRRASTDTPQIIMGAIGGVVTGYILWLAAISVGDGLTTVSQWSRVVLLLSVLVAVCGAA
GGLRLRSRGKLAWSAFAFSLPIPPVVLTVAVLADIYL*

Genomic Sequence

>Rv0463
ATGACGAGGCGCGCGAGCACTGACACCCCCCAGATCATCATGGGTGCCATCGGTGGTGTG
GTTACCGGCTACATCCTCTGGCTGGCGGCGATCTCCGTCGGCGATGGTCTGACGACGGTG
AGTCAATGGAGTCGCGTGGTGTTATTGCTGTCGGTCCTGGTGGCGGTGTGCGGCGCGGCG
GGCGGCTTGCGGCTGCGCAGCCGCGGCAAGCTCGCGTGGTCGGCGTTTGCTTTCAGTTTG
CCGATTCCTCCCGTGGTGCTGACCGTGGCGGTGCTGGCCGACATCTACCTTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,AB. Makar,KE. McMartin,M. Palese,TR. Tephly Formate assay in body fluids: application in methanol poisoning. Biochem Med 1975
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,G. Petec,R. Vîlcu,M. Uluitu,M. Petec Relationship between bovine serum albumin structure and its chemical equilibria with hydrogen and 5-hydroxytryptamine ions. Physiologie 1975
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,KS. Bose,RH. Sarma Delineation of the intimate details of the backbone conformation of pyridine nucleotide coenzymes in aqueous solution. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv2710	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,DR. Idler,MP. Burton The pronephroi as the site of presumptive interrenal cells in the hagfish Myxine glutinosa L. Comp Biochem Physiol A Comp Physiol 1976
Interaction	RegulatedBy Rv2710	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008