Rv0476 - conserved membrane protein

Expression: Most Significant Conditions for Rv0476

Protein Domains

Gene Information
Locus	Rv0476
Symbol
Gene Name	conserved membrane protein
Location	566508 - 566771 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:264 bp Protein:88 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	148
Related Genes	Acel_0070 CE0395 cg0453 DIP0376 jk1924 MAP3969 MAV_4674 Mkms_0657 ML2453 Mmcs_0644 MSMEG_0920 MUL_4544 Mvan_0809 nfa52070 RHA1_ro02103 SAV4010
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0476
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0476 Transcript 1
MLVLLVAVLVTAVYAFVHAALQRPDAYTAADKLTKPVWLVILGAAVALASILYPVLGVLG
MAMSACASGVYLVDVRPKLLEIQGKSR*

Genomic Sequence

>Rv0476
ATGCTGGTATTGCTGGTCGCCGTCTTGGTGACAGCGGTGTACGCGTTTGTGCATGCTGCG
TTGCAGCGGCCCGATGCCTATACCGCCGCCGACAAGCTGACCAAGCCGGTGTGGTTGGTG
ATCCTGGGCGCGGCCGTGGCGTTGGCCTCCATCCTGTATCCCGTTTTGGGTGTGCTCGGG
ATGGCGATGTCCGCCTGTGCGTCCGGCGTGTATCTGGTCGACGTGCGGCCCAAGCTTCTC
GAGATTCAGGGCAAGTCGCGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv0477	active	sourish10	2012-10-05
	Co-expression (Functional linkage) SL. Mueller-Ortiz, E. Sepulveda et al. Decreased infectivity despite unaltered C3 binding by a DeltahbhA mutant of Mycobacterium tuberculosis. Infect. Immun. 2002
Interaction	Transcription Rv0478	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) SL. Mueller-Ortiz, E. Sepulveda et al. Decreased infectivity despite unaltered C3 binding by a DeltahbhA mutant of Mycobacterium tuberculosis. Infect. Immun. 2002
Interaction	Transcription Rv0477	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) SL. Mueller-Ortiz, E. Sepulveda et al. Decreased infectivity despite unaltered C3 binding by a DeltahbhA mutant of Mycobacterium tuberculosis. Infect. Immun. 2002
Interaction	Transcription Rv0475	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) SL. Mueller-Ortiz, E. Sepulveda et al. Decreased infectivity despite unaltered C3 binding by a DeltahbhA mutant of Mycobacterium tuberculosis. Infect. Immun. 2002
Interaction	Transcription Rv0475	active	sourish10	2012-10-05
	Co-expression (Functional linkage) SL. Mueller-Ortiz, E. Sepulveda et al. Decreased infectivity despite unaltered C3 binding by a DeltahbhA mutant of Mycobacterium tuberculosis. Infect. Immun. 2002