Rv0516c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0516c

Protein Domains

Gene Information
Locus	Rv0516c
Symbol
Gene Name	conserved hypothetical protein
Location	608059 - 608535 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:477 bp Protein:159 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13044
Related Genes	MAP4007c MAV_4635 Mkms_0369 Mmcs_0359 MSMEG_0586 MT0537 MUL_0605 Mvan_0395
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0516c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0516c Transcript 1
MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVR
RFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALVASPAVVEQLGGRCDQG
EHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA*

Genomic Sequence

>Rv0516c
ATGACTACCACGATCCCGACGTCAAAATCGGCTTGCAGCGTCACGACGCGGCCCGGAAAT
GCCGCCGTTGACTACGGTGGCGCTCAGATTCGGGCCTACCTGCATCACCTGGCGACAGTG
GTGACCATCCGAGGCGAGATCGACGCCGCCAATGTCGAGCAGATCAGCGAGCACGTCCGG
CGTTTCAGCCTCGGAACAAATCCGATGGTGCTCGACCTGAGCGAGTTGAGTCACTTCAGT
GGGGCCGGCATCTCGCTCTTGTGCATCCTCGATGAGGACTGCCGAGCCGCCGGCGTCCAG
TGGGCATTAGTCGCGAGCCCCGCAGTAGTCGAACAGCTAGGTGGCCGCTGTGACCAGGGC
GAGCATGAATCCATGTTCCCGATGGCGCGCTCGGTGCATAAAGCGCTCCACGACCTGGCT
GACGCCATCGACCGCCGCCGTCAGCTGGTGCTACCGCTAATCAGCAGGTCAGCCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Signaling Rv0931c	active	priyadarshinipriyanka2001	2012-10-05
	spectrophotometric Analysis AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv0931c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv3287c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3286c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3687c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv2638	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3287c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv3286c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv3687c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv2638	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) AE. Greenstein, JA. MacGurn et al. M. tuberculosis Ser/Thr protein kinase D phosphorylates an anti-anti-sigma factor homolog. PLoS Pathog. 2007
Interaction	Regulatory Rv3287c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Regulatory Rv3286c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Regulatory Rv3687c	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Regulatory Rv2638	active	yashabhasin	2012-10-05
	Yeast two-hybrid (Physical interaction) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003