Rv0572c - hypothetical protein

Expression: Most Significant Conditions for Rv0572c

Protein Domains

Gene Information
Locus	Rv0572c
Symbol
Gene Name	hypothetical protein
Location	665042 - 665383 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:342 bp Protein:114 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8127
Related Genes	MT0599 Mvan_2913
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0572c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0572c Transcript 1
MGEHAIKRHMRQRKPTKHPLAQKRGARILVFTDDPRRSVLIVPGCHLDSMRREKNAYYFQ
DGNALVGMVVSGGTVEYDADDRTYVVQLTDGRHTTESSFEHSSPSRSPQSDDL*

Genomic Sequence

>Rv0572c
ATGGGTGAGCACGCCATCAAGCGGCACATGCGGCAACGGAAGCCTACGAAGCATCCCCTA
GCCCAGAAACGGGGCGCGCGGATTCTGGTCTTCACCGACGATCCCCGCAGGAGCGTCCTC
ATAGTGCCCGGTTGCCACCTGGATTCCATGCGCCGAGAAAAGAACGCGTACTACTTCCAG
GACGGCAATGCGTTGGTTGGGATGGTTGTCTCGGGCGGCACGGTTGAGTACGACGCCGAC
GACCGCACATATGTCGTGCAGCTCACCGACGGAAGGCACACCACTGAGTCATCTTTCGAA
CACTCATCGCCGAGTCGATCACCTCAATCCGATGACCTATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv0494	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003