Rv0592 - MCE-family protein mce2D

Expression: Most Significant Conditions for Rv0592

Protein Domains

Gene Information
Locus	Rv0592
Symbol	mce2D
Gene Name	MCE-family protein mce2D
Location	690501 - 692027 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1527 bp Protein:509 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21309
Related Genes	MAP4087 MAV_4548 MT0622
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0592
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0592 Transcript 1
MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLTTTTVVAYFSEALALY
PGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATASILNPSLVASRTIQLSP
PYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTERQPKGPFGDLIESAADN
LAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSALYQNDQQFVALNENLAEF
TDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVNNLADATTTLVQPEPRDGLE
TALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLICSAIQAGSRLGYQESAELCA
QYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERLRPPPGYKDTTVPGIFSRDTPF
SHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLGGPDIAPPPPGTNLPGPPNAYDE
SNPLPPPWYPQPASLPAAGATGQPGPGQ*

Genomic Sequence

>Rv0592
ATGAGCACCATCTTCGACATCCGCAGCCTGCGACTGCCGAAACTGTCTGCAAAGGTAGTG
GTCGTCGGCGGGTTGGTGGTGGTCTTGGCGGTCGTGGCCGCTGCGGCCGGCGCGCGGCTC
TACCGGAAACTGACTACCACTACCGTGGTCGCGTATTTCTCTGAGGCGCTCGCGCTGTAC
CCAGGAGACAAAGTCCAGATCATGGGTGTGCGGGTCGGTTCTATCGACAAGATCGAGCCG
GCCGGCGACAAGATGCGAGTCACGTTGCACTACAGCAACAAATACCAGGTGCCGGCCACG
GCTACCGCGTCGATCCTCAACCCCAGCCTGGTGGCCTCGCGCACCATCCAGCTGTCACCG
CCGTACACCGGCGGCCCGGTCTTGCAAGACGGCGCGGTGATCCCAATCGAGCGCACCCAG
GTGCCCGTCGAGTGGGATCAGTTGCGCGATTCCATCAATGGGATCCTCCGCCAGCTCGGC
CCGACGGAGCGGCAGCCGAAGGGGCCGTTCGGCGACCTCATCGAATCGGCCGCGGACAAC
CTGGCCGGCAAGGGCAGGCAGCTCAACGAAACGCTGAACAGTTTGTCGCAGGCGTTGACC
GCGCTGAACGAGGGCCGGGGAGACTTCGTTGCGATCACGCGAAGCCTGGCGCTATTTGTC
AGCGCGCTCTACCAGAATGATCAACAGTTCGTTGCGCTCAACGAAAACCTTGCCGAGTTC
ACCGACTGGTTCACCAAATCCGACCATGACTTGGCCGACACGGTGGAACGGATCGACGAC
GTTCTCGGCACCGTCCGAAAGTTCGTGAGCGACAACAGATCCGTGCTGGCTGCCGATGTC
AACAACCTCGCCGACGCGACCACTACACTAGTGCAACCCGAGCCGCGGGACGGTCTGGAA
ACCGCGTTGCACGTGTTGCCGACCTACGCCAGCAACTTCAACAACCTTTACTATCCACTG
CACAGCTCTCTGGTGGGCCAGTTCGTGTTCCCCAACTTCGCGAACCCAATTCAGCTCATT
TGCAGCGCTATTCAGGCCGGCAGCCGACTCGGCTATCAGGAATCCGCCGAGCTGTGCGCG
CAGTACTTGGCACCGGTTCTGGACGCTCTCAAGTTCAATTACTTGCCGTTCGGCTCAAAC
CCGTTCAGTTCGGCGGCCACTTTGCCCAAGGAGGTGGCTTACTCCGAGGAGCGGCTCCGC
CCGCCGCCCGGGTACAAGGACACCACTGTCCCAGGGATCTTCTCGCGGGACACACCGTTT
TCACACGGCAACCATGAACCGGGCTGGGTCGTTGCGCCCGGGATGCAGGGTATGCAGGTT
CAGCCGTTTACCGCGAACATGCTCACCCCGGAATCGCTGGCAGAGCTGCTGGGTGGTCCG
GATATTGCCCCCCCGCCGCCGGGAACCAACTTGCCCGGACCGCCGAATGCGTATGACGAG
TCCAATCCGTTGCCGCCGCCGTGGTACCCGCAGCCCGCGTCCCTCCCGGCTGCGGGCGCC
ACAGGACAGCCAGGCCCGGGCCAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,M. Alonso-Hearn,TM. Eckstein,S. Sommer,LE. Bermudez A Mycobacterium avium subsp. paratuberculosis LuxR regulates cell envelope and virulence. Innate Immun 2010
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0590A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0590A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0594	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0593	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0590A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0591	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0590A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0590A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0590A	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0590	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) AK. Das, D. Mitra et al. Predicted molecular structure of the mammalian cell entry protein Mce1A of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2003
Interaction	Operon Rv0589	active	kholia.trupti	2012-10-05
	Co-expression (Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv0586	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0586	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0586	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0586	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	RegulatedBy Rv0586	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008