Rv0596c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0596c

Protein Domains

Gene Information
Locus	Rv0596c
Symbol
Gene Name	conserved hypothetical protein
Location	695228 - 695485 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:258 bp Protein:86 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8884
Related Genes	MT0626
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0596c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0596c Transcript 1
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVR
LGPDTTNLGEELRETLTQTTDDVRW*

Genomic Sequence

>Rv0596c
ATGTCTGCTACGATACCCGCTCGCGATCTTCGCAACCACACCGCCGAGGTACTGCGGCGA
GTTGCCGCCGGCGAGGAAATCGAGGTGCTCAAGGACAATCGCCCCGTAGCGCGCATCGTT
CCGCTCAAGCGGCGCCGCCAATGGTTGCCAGCTGCCGAGGTGATCGGCGAACTGGTGCGC
TTGGGCCCCGATACCACCAATCTGGGCGAGGAGCTGCGAGAGACGCTGACGCAAACCACG
GACGATGTGCGGTGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv0595c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibition Rv0595c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv0595c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,DJ. Beste,M. Espasa,B. Bonde,AM. Kierzek,GR. Stewart,J. McFadden The genetic requirements for fast and slow growth in mycobacteria. PLoS ONE 2009
Interaction	Inhibition Rv0595c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibition Rv0595c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv0595c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,DJ. Beste,M. Espasa,B. Bonde,AM. Kierzek,GR. Stewart,J. McFadden The genetic requirements for fast and slow growth in mycobacteria. PLoS ONE 2009
Symbol	VapB	active	jlew	2012-03-07
	Rescues growth inhibition in MS authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB4	active	jlew	2012-03-07
	Relieves toxin activity. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar in part to other M. tuberculosis hypothetical proteins e.g. Rv0626, Rv3181c, Rv3385c, Rv3407, etc.
Other	stop:695485	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar in part to other M. tuberculosis hypothetical proteins e.g. Rv0626, Rv3181c, Rv3385c, Rv3407, etc.
Other	start:695228	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar in part to other M. tuberculosis hypothetical proteins e.g. Rv0626, Rv3181c, Rv3385c, Rv3407, etc.
Symbol	Vap BC-4	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar in part to other M. tuberculosis hypothetical proteins e.g. Rv0626, Rv3181c, Rv3385c, Rv3407, etc.