Rv0626 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0626

Protein Domains

Gene Information
Locus	Rv0626
Symbol
Gene Name	conserved hypothetical protein
Location	718025 - 718285 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:261 bp Protein:87 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8441
Related Genes	MAP2028c MT0654
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0626
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0626 Transcript 1
MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTEFLSRLRG
AQADPGLRNDLAVLAGDTTEDLGPIR*

Genomic Sequence

>Rv0626
ATGTCTGAGGTGGCCTCGCGTGAGCTGCGTAACGATACGGCCGGCGTGCTGCGCCGCGTG
CGGGCAGGGGAGGACGTCACCATCACCGTCAGCGGCCGTCCGGTCGCGGTGCTTACCCCG
GTTCGTCCGCGGCGCCGGCGTTGGCTGAGCAAAACGGAGTTCCTGTCGCGGTTGCGCGGC
GCTCAAGCCGATCCCGGGCTCCGTAACGACCTCGCGGTCCTTGCCGGCGACACGACCGAG
GATCTCGGGCCGATCCGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Operon(Physical Interaction) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv0627	active	harsharohiratruefriend	2012-10-05
	Co-expression (Functional linkage) authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Symbol	VapB	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	vapB5	active	jlew	2012-03-07
	VapBC5 structure. Assay shows the toxin is an Mg-enabled endoribonuclease authors,L. Miallau,M. Faller,J. Chiang,M. Arbing,F. Guo,D. Cascio,D. Eisenberg Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Symbol	VapB5	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv0596c, Rv3385c, Rv3407,Rv3181c, etc.
Other	stop:718285	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv0596c, Rv3385c, Rv3407,Rv3181c, etc.
Other	start:718025	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv0596c, Rv3385c, Rv3407,Rv3181c, etc.
Symbol	Vap BC-5	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv0596c, Rv3385c, Rv3407,Rv3181c, etc.