Rv0651 - 50S ribosomal protein L10 rplJ

Expression: Most Significant Conditions for Rv0651

Protein Domains

Gene Information
Locus	Rv0651
Symbol	rplJ
Gene Name	50S ribosomal protein L10 rplJ
Location	748276 - 748812 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:537 bp Protein:179 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	191
Related Genes	Acel_0297 BL1549 CE0493 cg0572 DIP0436 jk1849 MAP4125 MAV_4508 Mkms_0984 ML1896 Mmcs_0966 MSMEG_1364 MT0680 MUL_0741 Mvan_1252 nfa51120 PPA1887 RHA1_ro01976 SAV4912
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0651
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0651 Transcript 1
MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTGSATYAVAKNTLIKRA
ASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALVIKGGYMDGHPLTVAEV
ERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAAALQEKKACPGPDSAE*

Genomic Sequence

>Rv0651
ATGGCCAGGGCTGACAAGGCCACCGCCGTCGCAGACATCGCAGCGCAGTTCAAGGAGTCG
ACCGCGACGTTGATCACCGAATACCGCGGCTTGACGGTGGCCAACCTGGCCGAGCTACGC
AGGTCTCTGACGGGGTCGGCGACCTACGCGGTGGCCAAAAACACACTCATCAAGCGGGCG
GCCTCCGAGGCCGGCATCGAGGGCCTCGACGAACTGTTTGTGGGCCCCACCGCGATCGCG
TTCGTCACCGGTGAGCCGGTCGACGCCGCCAAGGCCATCAAGACCTTCGCCAAGGAGCAC
AAGGCGCTGGTCATCAAGGGCGGCTACATGGACGGCCACCCATTGACCGTGGCCGAAGTC
GAGCGCATCGCCGACCTGGAGTCCCGCGAGGTGTTACTGGCCAAGCTGGCCGGTGCGATG
AAGGGCAACCTGGCCAAGGCGGCCGGGTTGTTCAACGCGCCGGCCTCGCAGCTGGCCCGG
CTCGCGGCCGCCCTGCAGGAAAAGAAGGCCTGCCCAGGCCCAGACTCAGCCGAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0652	active	sourish10	2012-10-05
	Structural analysis authors,MJ. Garcia,MC. Nuñez,RA. Cox Measurement of the rates of synthesis of three components of ribosomes of Mycobacterium fortuitum: a theoretical approach to qRT-PCR experimentation. PLoS ONE 2010
Interaction	PhysicalInteraction Rv0652	active	ahal4789	2012-10-05
	Structural analysis authors,MJ. Garcia,MC. Nuñez,RA. Cox Measurement of the rates of synthesis of three components of ribosomes of Mycobacterium fortuitum: a theoretical approach to qRT-PCR experimentation. PLoS ONE 2010
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003