Rv0657c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0657c

Protein Domains

Gene Information
Locus	Rv0657c
Symbol
Gene Name	conserved hypothetical protein
Location	753462 - 753617 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:156 bp Protein:52 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8894
Related Genes	MT0686 SAV5693
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0657c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0657c Transcript 1
MSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE*

Genomic Sequence

>Rv0657c
GTGTCGGTGACCCAGATCGACCTCGACGACGAAGCGCTGGCCGATGTGATGCGCATCGCC
GCCGTGCACACAAAGAAGGAAGCCGTGAACCTCGCGATGCGCGATTACGTCGAACGGTTT
CGGCGCATCGAGGCCCTGGCCCGCTCGCGCGAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv0656c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0656c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0656c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv0656c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapB6	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	SC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
Other	stop:753617	active	rslayden	2012-03-05
	SC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
Other	start:753462	active	rslayden	2012-03-05
	SC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
Symbol	Vap BC-6	active	rslayden	2012-03-05
	SC4H8_7 from Streptomyces coelicolor (66aa), FASTA score: (41.0% identity in 39 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Q10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
Other	stop:753617	active	rslayden	2012-03-05
	Q10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
Other	start:753462	active	rslayden	2012-03-05
	Q10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
Symbol	Vap BC-6	active	rslayden	2012-03-05
	Q10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958
Other	strand:+	active	rslayden	2012-03-05
	YW08_MYCTU
Other	stop:753617	active	rslayden	2012-03-05
	YW08_MYCTU
Other	start:753462	active	rslayden	2012-03-05
	YW08_MYCTU
Symbol	Vap BC-6	active	rslayden	2012-03-05
	YW08_MYCTU
Other	strand:+	active	rslayden	2012-03-05
	MTCY39.08c
Other	stop:753617	active	rslayden	2012-03-05
	MTCY39.08c
Other	start:753462	active	rslayden	2012-03-05
	MTCY39.08c
Symbol	Vap BC-6	active	rslayden	2012-03-05
	MTCY39.08c
Other	strand:+	active	rslayden	2012-03-05
	MT2064.1
Other	stop:753617	active	rslayden	2012-03-05
	MT2064.1
Other	start:753462	active	rslayden	2012-03-05
	MT2064.1
Symbol	Vap BC-6	active	rslayden	2012-03-05
	MT2064.1
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
Other	stop:753617	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
Other	start:753462	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009
Symbol	Vap BC-6	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009