Rv0661c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0661c

Protein Domains

Gene Information
Locus	Rv0661c
Symbol
Gene Name	conserved hypothetical protein
Location	755335 - 755772 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:438 bp Protein:146 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8897
Related Genes	MT0690
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0661c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0661c Transcript 1
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDA
AALGRVTMPNCSRRYSPSIEATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADP
AFADLSDVVHVIPDAAGMVSLLGDR*

Genomic Sequence

>Rv0661c
ATGATAGTGCTCGACACCACCGTCCTCGTCTATGCCAAAGGCGCCGAGCATCCACTCCGC
GATCCCTGCCGCGATCTCGTCGCGGCAATCGCCGACGAACGCATCGCTGCGACCACCACC
GCCGAGGTGATCCAGGAGTTCGTCCACGTACGCGCCCGCCGGCGCGACCGCAGCGACGCC
GCCGCGCTGGGCCGTGTGACTATGCCGAACTGCTCTCGCCGCTACTCACCATCAATCGAG
GCCACCTCGAAGCGCGGCCTGACGCTGTTCGAGACAACGCCAGGGCTTGAAGCCTGCGAC
GCGGTGCTCGCGGCGGTTGCCGCAAGCGCCGGCGCGACCGCTCTTGTCTCGGCTGACCCG
GCGTTCGCCGATCTGTCGGATGTCGTGCACGTCATTCCCGACGCGGCCGGGATGGTCAGC
CTGCTCGGCGACCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv0662c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0662c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0662c	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0662c	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapC7	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTV041.23 (163 aa); Rv0277c, Rv2530c, etc.
Other	stop:755772	active	rslayden	2012-03-05
	MTV041.23 (163 aa); Rv0277c, Rv2530c, etc.
Other	start:755335	active	rslayden	2012-03-05
	MTV041.23 (163 aa); Rv0277c, Rv2530c, etc.
Other	strand:+	active	rslayden	2012-03-05
	MTV003_7 (126 aa), FASTA scores: E():0.00087, (30.4% identity in 125 aa overlap), Rv0749
Other	stop:755772	active	rslayden	2012-03-05
	MTV003_7 (126 aa), FASTA scores: E():0.00087, (30.4% identity in 125 aa overlap), Rv0749
Other	start:755335	active	rslayden	2012-03-05
	MTV003_7 (126 aa), FASTA scores: E():0.00087, (30.4% identity in 125 aa overlap), Rv0749
Other	strand:+	active	rslayden	2012-03-05
	MTV003.09
Other	stop:755772	active	rslayden	2012-03-05
	MTV003.09
Other	start:755335	active	rslayden	2012-03-05
	MTV003.09
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv2863
Other	stop:755772	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv2863
Other	start:755335	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis hypothetical proteins e.g. Rv2863