Rv0665 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0665

Protein Domains

Gene Information
Locus	Rv0665
Symbol
Gene Name	conserved hypothetical protein
Location	758801 - 759139 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:339 bp Protein:113 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11545
Related Genes	MT0693
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0665
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0665 Transcript 1
MTEGEVGVGLLDTSVFIARESGGAIADLPERVALSVMTIGELQLGLLNAGDSATRSRRAD
TLALARTADQIPVSEAVMISLARLVADCRAAGVRRSVKLTDALIAATAEIKV*

Genomic Sequence

>Rv0665
GTGACCGAGGGCGAGGTCGGGGTAGGCCTGCTAGATACGTCGGTCTTCATTGCGCGCGAG
AGCGGCGGTGCAATCGCGGACCTGCCTGAACGCGTGGCGCTTTCGGTTATGACGATCGGT
GAGCTGCAACTCGGTCTGCTCAATGCTGGCGATTCGGCGACCCGATCACGACGCGCCGAC
ACCCTCGCGCTAGCGCGCACGGCCGATCAGATCCCTGTCAGTGAAGCGGTGATGATTTCG
TTGGCTCGACTCGTCGCGGACTGCCGAGCCGCGGGCGTGCGGCGGTCGGTGAAGCTGACC
GACGCTCTCATTGCGGCAACCGCGGAGATCAAGGTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	InhibitedBy Rv0664	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0664	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0664	active	ashwinigbhat	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv0664	active	priti.priety	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapC8	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0627 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (135aa), and showing similarity with Rv0595c.
Other	stop:759139	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0627 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (135aa), and showing similarity with Rv0595c.
Other	start:758801	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0627 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (135aa), and showing similarity with Rv0595c.