Rv0670 - endonuclease IV end

Expression: Most Significant Conditions for Rv0670

Protein Domains

Gene Information
Locus	Rv0670
Symbol	end
Gene Name	endonuclease IV end
Location	769792 - 770550 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:759 bp Protein:253 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2938
Related Genes	Acel_0985 BL0757 MAP4132 MAV_4501 Mkms_0990 ML1889 Mmcs_0972 MSMEG_1383 MT0699 MUL_0751 Mvan_1261 nfa46690 PPA2235 SAV6091
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0670
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0670 Transcript 1
MLIGSHVSPTDPLAAAEAEGADVVQIFLGNPQSWKAPKPRDDAAALKAATLPIYVHAPYL
INLASANNRVRIPSRKILQETCAAAADIGAAAVIVHGGHVADDNDIDKGFQRWRKALDRL
ETEVPVYLENTAGGDHAMARRFDTIARLWDVIGDTGIGFCLDTCHTWAAGEALTDAVDRI
KAITGRIDLVHCNDSRDEAGSGRDRHANLGSGQIDPDLLVAAVKAAGAPVICETADQGRK
DDIAFLRERTGS*

Genomic Sequence

>Rv0670
GTGCTCATTGGTTCGCATGTCAGCCCAACCGATCCGCTGGCCGCAGCGGAGGCCGAAGGC
GCTGACGTAGTGCAGATTTTCCTTGGCAATCCGCAGAGCTGGAAGGCTCCCAAGCCGCGG
GACGACGCCGCCGCGCTGAAAGCCGCGACCCTGCCCATCTACGTGCATGCGCCCTACCTG
ATCAACCTTGCGTCGGCGAACAATCGCGTGCGGATCCCGTCGCGCAAGATCCTGCAAGAG
ACCTGTGCTGCGGCGGCCGACATTGGCGCAGCGGCGGTGATCGTGCACGGTGGGCACGTC
GCCGACGACAACGACATCGACAAGGGCTTCCAGCGCTGGCGCAAGGCGCTGGACCGGCTG
GAAACCGAGGTTCCCGTCTACCTGGAAAACACCGCCGGCGGCGATCACGCGATGGCGCGC
CGCTTCGACACCATCGCCCGGCTCTGGGACGTCATCGGCGACACCGGAATCGGGTTTTGC
CTGGACACCTGCCACACCTGGGCGGCCGGCGAGGCGCTGACCGATGCCGTCGATCGGATC
AAAGCAATTACCGGCCGCATCGATCTGGTGCACTGCAACGACTCCAGGGACGAAGCGGGA
TCGGGCCGTGACCGCCACGCCAACCTCGGCAGCGGCCAGATTGATCCTGACCTGCTGGTG
GCTGCCGTCAAGGCGGCCGGCGCGCCGGTGATCTGCGAAACCGCCGACCAAGGTCGCAAG
GACGACATCGCGTTTCTGCGGGAAAGAACCGGCAGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0586	active	sourish10	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0586	active	sourish10	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulatory Rv0586	active	ahal4789	2012-10-05
	Physical Interaction MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	Regulatory Rv0586	active	ahal4789	2012-10-05
	Physical Interaction authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv0586	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Other	TBPWY:Base excision repair (BER)	active	vmizrahi	2012-03-05
	Required for survival during early stages of infection in mice (Sassetti & Rubin, 2003).
Symbol	end, nfo	active	vmizrahi	2012-03-05
	Required for survival during early stages of infection in mice (Sassetti & Rubin, 2003).