Rv0707 - 30S ribosomal protein S3 rpsC

Expression: Most Significant Conditions for Rv0707

Protein Domains

Gene Information
Locus	Rv0707
Symbol	rpsC
Gene Name	30S ribosomal protein S3 rpsC
Location	804282 - 805106 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:825 bp Protein:275 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	209
Related Genes	Acel_0312 BL1584 CE0528 cg0601 DIP0479 jk1827 MAP4167 MAV_4465 Mkms_1036 ML1857 Mmcs_1019 MSMEG_1442 MT0734 MUL_0796 Mvan_1311 nfa7390 PPA1857 RHA1_ro06139 SAV4932
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0707
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0707 Transcript 1
MGQKINPHGFRLGITTDWKSRWYADKQYAEYVKEDVAIRRLLSSGLERAGIADVEIERTR
DRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGVA
EQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRA
DIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGA
SGTTATGTDAGRAAGGEEAAPDAAAPVEAQSTES*

Genomic Sequence

>Rv0707
GTGGGCCAAAAGATCAATCCGCATGGCTTCCGGCTGGGCATCACCACCGACTGGAAGTCG
CGCTGGTATGCCGACAAGCAGTATGCCGAGTACGTCAAGGAGGACGTGGCGATCCGCCGG
CTGCTGTCCAGTGGCCTAGAGCGTGCTGGGATCGCCGATGTAGAGATCGAGCGGACCCGC
GACCGGGTCCGGGTGGACATTCACACCGCGCGTCCGGGCATCGTCATTGGTCGGCGTGGG
ACCGAGGCCGACCGGATTCGTGCCGACCTGGAAAAGCTGACCGGCAAGCAGGTCCAGCTC
AACATCCTGGAGGTCAAAAACCCGGAGTCGCAAGCGCAATTAGTGGCCCAGGGGGTAGCC
GAGCAGTTGAGCAACCGGGTGGCGTTCCGCCGCGCAATGCGCAAGGCGATCCAGTCGGCG
ATGCGTCAGCCCAACGTCAAGGGAATCCGGGTGCAGTGCTCGGGCCGCCTCGGCGGCGCG
GAAATGAGCCGCTCGGAGTTCTACCGCGAGGGCCGCGTCCCGCTGCACACCTTGCGGGCA
GATATCGACTACGGCCTATACGAGGCCAAGACCACCTTCGGCCGGATCGGTGTGAAGGTG
TGGATCTACAAGGGTGACATCGTGGGCGGCAAACGTGAATTGGCTGCCGCCGCGCCAGCG
GGCGCCGACCGTCCGCGCCGTGAGCGGCCGTCGGGCACGCGCCCCCGTCGCAGCGGTGCT
TCGGGCACCACGGCGACCGGTACCGACGCGGGTCGGGCCGCGGGTGGCGAAGAGGCCGCG
CCTGACGCCGCAGCGCCCGTTGAAGCGCAGAGCACGGAGAGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0709	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0708	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0710	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0709	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0708	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0706	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0705	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0704	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0703	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0702	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0701	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0700	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0705	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0703	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	Regulatory Rv0703	active	ravirajsoni	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003