Rv0708 - 50S ribosomal protein L16 rplP

Expression: Most Significant Conditions for Rv0708

Protein Domains

Gene Information
Locus	Rv0708
Symbol	rplP
Gene Name	50S ribosomal protein L16 rplP
Location	805110 - 805526 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:417 bp Protein:139 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	210
Related Genes	Acel_0313 BL1586 CE0529 cg0602 DIP0480 jk1826 MAP4168 MAV_4464 Mkms_1037 ML1856 Mmcs_1020 MSMEG_1443 MT0735 MUL_0797 Mvan_1312 nfa7400 PPA1856 RHA1_ro06140 SAV4933
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0708
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0708 Transcript 1
MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKR
GGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTR
AIHKLPIKARIITREEQF*

Genomic Sequence

>Rv0708
ATGTTGATTCCCCGTAAGGTTAAACATCGCAAGCAGCACCATCCTCGCCAGCGCGGCATC
GCCAGCGGCGGCACCACGGTGAACTTCGGCGACTACGGCATTCAGGCCCTTGAGCACGCC
TATGTCACCAACCGGCAGATCGAATCGGCGCGTATCGCCATCAACCGGCACATCAAGCGT
GGCGGCAAGGTTTGGATCAACATCTTCCCTGACCGCCCGCTGACCAAGAAGCCCGCCGAA
ACCCGCATGGGTTCGGGCAAGGGCTCGCCGGAGTGGTGGGTAGCCAACGTTAAGCCGGGC
CGGGTGCTGTTCGAGCTCAGTTACCCCAATGAAGGTGTCGCCCGGGCCGCGCTCACCCGA
GCGATCCACAAGCTGCCGATCAAGGCACGCATTATTACTCGAGAGGAGCAGTTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0709	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0710	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0709	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0707	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0706	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0705	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0704	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0703	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0702	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0701	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0700	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0707	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0705	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0703	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	Regulatory Rv0703	active	ravirajsoni	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001