Rv0710 - 30S ribosomal protein S17 rpsQ

Expression: Most Significant Conditions for Rv0710

Protein Domains

Gene Information
Locus	Rv0710
Symbol	rpsQ
Gene Name	30S ribosomal protein S17 rpsQ
Location	805756 - 806166 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:411 bp Protein:137 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	212
Related Genes	Acel_0315 BL1589 CE0531 cg0604 DIP0482 jk1824 MAP4170 MAV_4462 Mkms_1039 ML1854 Mmcs_1022 MSMEG_1445 MT0737 MUL_0799 Mvan_1314 nfa7420 PPA1853 RHA1_ro06142 SAV4935
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0710
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0710 Transcript 1
MMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPRTPKPRGRRKT
RIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETRPL
SATKRWRLVEILEKAK*

Genomic Sequence

>Rv0710
GTGATGGCAGAGGCTAAGACCGGCGCGAAGGCGGCGCCTAGGGTGGCTAAGGCCGCCAAG
GCGGCCCCCAAGAAGGCCGCACCCAACGACGCTGAGGCCATAGGTGCGGCCAACGCGGCA
AACGTTAAGGGGCCCAAGCACACTCCGCGTACTCCGAAGCCACGCGGCCGCCGCAAGACA
CGAATCGGCTATGTGGTGAGCGACAAAATGCAGAAGACCATTGTGGTGGAGCTGGAAGAC
CGCATGCGGCACCCGCTATACGGCAAGATCATCCGGACCACTAAGAAGGTCAAGGCACAC
GACGAAGACAGCGTTGCCGGCATTGGCGACCGTGTCTCGCTGATGGAGACGCGTCCGCTG
TCGGCGACCAAGCGCTGGCGGCTCGTCGAGATCCTCGAGAAGGCTAAGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0709	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0708	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0707	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0705	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv0703	active	ravirajsoni	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	Regulatory Rv0703	active	ravirajsoni	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003