Rv0732 - preprotein translocase secY

Expression: Most Significant Conditions for Rv0732

Protein Domains

Gene Information
Locus	Rv0732
Symbol	secY
Gene Name	preprotein translocase secY
Location	824800 - 826125 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1326 bp Protein:442 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	230
Related Genes	Acel_0326 BL1600 CE0564 cg0647 DIP0540 jk1766 MAP4198 MAV_4434 Mkms_1062 ML1833 Mmcs_1046 MSMEG_1483 MUL_0828 Mvan_1347 nfa7940 PPA1835 SAV4946
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0732
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0732 Transcript 1
MLSAFISSLRTVDLRRKILFTLGIVILYRVGAALPSPGVNFPNVQQCIKEASAGEAGQIY
SLINLFSGGALLKLTVFAVGVMPYITASIIVQLLTVVIPRFEELRKEGQAGQSKMTQYTR
YLAIALAILQATSIVALAANGGLLQGCSLDIIADQSIFTLVVIVLVMTGGAALVMWMGEL
ITERGIGNGMSLLIFVGIAARIPAEGQSILESRGGVVFTAVCAAALIIIVGVVFVEQGQR
RIPVQYAKRMVGRRMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLIRSGSGVVG
NSWWDKFVGTYLSDPSNLVYIGIYFGLIIFFTYFYVSITFNPDERADEMKKFGGFIPGIR
PGRPTADYLRYVLSRITLPGSIYLGVIAVLPNLFLQIGAGGTVQNLPFGGTAVLIMIGVG
LDTVKQIESQLMQRNYEGFLK*

Genomic Sequence

>Rv0732
GTGCTTTCGGCTTTCATCTCGTCGCTGCGAACAGTCGACTTGAGACGAAAGATCCTCTTC
ACGCTGGGCATCGTCATTCTCTACCGTGTCGGTGCCGCGCTGCCGTCCCCCGGTGTCAAT
TTTCCGAACGTGCAGCAGTGCATCAAAGAAGCCAGCGCGGGCGAAGCCGGACAGATCTAT
TCCCTGATCAACCTGTTCTCCGGCGGTGCGTTATTAAAGCTCACGGTGTTCGCGGTGGGG
GTGATGCCCTACATCACCGCCAGCATCATCGTGCAGCTGCTCACCGTGGTCATCCCGAGG
TTCGAGGAACTCCGGAAGGAAGGCCAGGCGGGTCAGTCGAAGATGACCCAGTACACCCGT
TACCTAGCGATCGCGTTGGCTATCCTTCAAGCCACCAGCATCGTGGCGTTGGCTGCCAAC
GGCGGGTTGCTACAAGGTTGCTCGCTGGACATCATCGCCGACCAGAGCATTTTCACACTG
GTCGTCATCGTGCTCGTGATGACGGGCGGCGCCGCGTTGGTGATGTGGATGGGCGAGTTG
ATCACCGAACGCGGCATCGGCAACGGCATGTCGCTGCTGATCTTCGTTGGCATCGCTGCC
CGCATCCCGGCCGAAGGTCAAAGCATCCTGGAAAGCCGCGGTGGAGTCGTCTTCACCGCG
GTCTGCGCGGCCGCGTTGATCATCATCGTCGGTGTGGTGTTCGTCGAACAGGGTCAGCGC
CGGATTCCAGTGCAATACGCCAAGCGCATGGTGGGCCGGCGGATGTATGGCGGGACTTCG
ACTTATCTGCCGCTCAAGGTCAACCAGGCCGGCGTTATCCCGGTTATCTTCGCGTCGTCG
CTGATCTACATTCCGCACCTGATCACCCAGCTGATTCGCAGCGGCAGCGGTGTCGTGGGA
AACAGCTGGTGGGACAAATTCGTCGGCACGTACCTGTCCGACCCGAGCAACCTGGTCTAC
ATCGGCATCTACTTCGGCCTCATCATCTTCTTCACCTACTTCTACGTGTCGATCACCTTC
AACCCCGACGAACGTGCCGACGAGATGAAGAAGTTCGGCGGCTTCATTCCGGGAATTCGG
CCGGGCCGTCCGACCGCAGACTATCTGCGCTATGTGCTGAGCCGGATTACCTTGCCGGGC
TCGATTTACCTCGGCGTGATCGCCGTGCTGCCCAACCTGTTCCTCCAGATCGGCGCCGGT
GGAACCGTGCAGAACCTGCCCTTTGGGGGTACCGCGGTGCTGATCATGATCGGTGTCGGT
TTGGATACGGTCAAGCAGATCGAGAGTCAGCTCATGCAGCGCAACTACGAAGGGTTCCTC
AAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) G. Anilkumar, R. Srinivasan et al. Genomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. Microbiology (Reading, Engl.) 2004
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Bacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. Microbiology (Reading, Engl.) 2001
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Analysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. Microbiol. Res. 2008
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) G. Anilkumar, MM. Chauhan et al. Cloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. Gene 1998
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,C. Herman,D. Thévenet,R. D'Ari,P. Bouloc Degradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. Proc. Natl. Acad. Sci. U.S.A. 1995
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. PLoS ONE 2008
Interaction	Translation Rv3610c	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) R. Srinivasan, G. Anilkumar et al. Functional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2006
Interaction	PhysicalInteraction Rv1440	active	shahanup86	2012-10-05
	authors,F. Duong Binding, activation and dissociation of the dimeric SecA ATPase at the dimeric SecYEG translocase. EMBO J. 2003
Interaction	PhysicalInteraction Rv0379	active	jgalag	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv0638	active	jgalag	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv1440	active	jgalag	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv0379	active	jgalag	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv0638	active	jgalag	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv1440	active	jgalag	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv1821	active	anshula.arora1990	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3240c	active	anshula.arora1990	2012-10-05
	Structural analysis JM. Hou, NG. D'Lima et al. ATPase activity of Mycobacterium tuberculosis SecA1 and SecA2 proteins and its importance for SecA2 function in macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv1821	active	anshula.arora1990	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv3240c	active	anshula.arora1990	2012-10-05
	Structural analysis authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	PhysicalInteraction Rv0638	active	prabhakarsmail	2012-10-05
	Structural Analysis authors,KL. Bieker,TJ. Silhavy PrlA (SecY) and PrlG (SecE) interact directly and function sequentially during protein translocation in E. coli. Cell 1990
Interaction	PhysicalInteraction Rv0638	active	prabhakarsmail	2012-10-05
	Structural Analysis authors,EH. Manting,C. van Der Does,H. Remigy,A. Engel,AJ. Driessen SecYEG assembles into a tetramer to form the active protein translocation channel. EMBO J. 2000
Interaction	PhysicalInteraction Rv0638	active	akankshajain.21	2012-10-05
	Structural Analysis authors,KL. Bieker,TJ. Silhavy PrlA (SecY) and PrlG (SecE) interact directly and function sequentially during protein translocation in E. coli. Cell 1990
Interaction	PhysicalInteraction Rv0638	active	akankshajain.21	2012-10-05
	Structural Analysis authors,EH. Manting,C. van Der Does,H. Remigy,A. Engel,AJ. Driessen SecYEG assembles into a tetramer to form the active protein translocation channel. EMBO J. 2000
Interaction	PhysicalInteraction Rv0379	active	manish.srcp	2012-10-05
	authors,C. Tziatzios,D. Schubert,M. Lotz,D. Gundogan,H. Betz,H. Schägger,W. Haase,F. Duong,I. Collinson The bacterial protein-translocation complex: SecYEG dimers associate with one or two SecA molecules. J. Mol. Biol. 2004
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001