Rv0735 - alternative RNA polymerase sigma factor sigL

Expression: Most Significant Conditions for Rv0735

Protein Domains

Gene Information
Locus	Rv0735
Symbol	sigL
Gene Name	alternative RNA polymerase sigma factor sigL
Location	827543 - 828076 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:534 bp Protein:178 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26412
Related Genes	MAP4201 MAP4217 MAV_4415 MAV_4431 Mkms_1065 Mmcs_1049 MSMEG_1486 MT0759 MUL_0831 Mvan_1350 nfa55120
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0735
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0735 Transcript 1
MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGD
TARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADAL
AQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR*

Genomic Sequence

>Rv0735
GTGGCTCGTGTGTCGGGCGCCGCGGCCGCTGAAGCCGCGTTGATGAGGGCGCTCTACGAC
GAGCATGCCGCCGTGTTGTGGCGTTACGCGCTGCGCTTGACCGGGGATGCGGCCCAAGCC
GAAGACGTCGTCCAAGAGACGCTGTTGCGGGCGTGGCAGCATCCGGAGGTGATCGGCGAC
ACCGCGCGGCCGGCAAGGGCGTGGTTGTTCACCGTCGCGCGCAACATGATCATCGACGAG
CGGCGCAGCGCCCGGTTCCGCAATGTGGTCGGTTCGACCGACCAATCGGGCACACCCGAG
CAGTCGACGCCGGACGAGGTGAACGCCGCACTGGATCGGCTGCTGATCGCCGATGCGCTG
GCCCAACTGTCCGCCGAGCATAGGGCCGTGATCCAGCGGTCCTACTACCGCGGATGGTCG
ACCGCACAGATTGCCACCGACCTCGGAATTGCCGAAGGAACGGTGAAGTCGCGATTGCAC
TACGCCGTGCGCGCGTTGCGGCTCACTCTGCAGGAACTGGGAGTTACTCGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3895c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Transcription Rv3895c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
Interaction	Regulatory Rv2878c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv2877c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv1696	active	salluamity1	2012-10-05
	Co-expression (Functional linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv1665	active	ashwinigbhat	2012-10-05
	E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv1665	active	priti.priety	2012-10-05
	E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	Regulatory Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	Regulatory Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv1660	active	ashwinigbhat	2012-10-05
	E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv1660	active	ashwinigbhat	2012-10-05
	authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
Interaction	Regulatory Rv1660	active	priti.priety	2012-10-05
	E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv1660	active	priti.priety	2012-10-05
	authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
Interaction	Regulatory Rv1146	active	aparna.vchalam	2012-10-05
	In vitro transcription assay authors,RR. Scherberger,H. Kaess,S. Brückner [Studies on the action of an anticholinergic agent in combination with a tranquilizer on gastric juice secretion in man]. Arzneimittelforschung 1975
Interaction	Regulatory Rv1146	active	aparna.vchalam	2012-10-05
	In vitro transcription assay authors,NJ. Loman,MJ. Pallen XDR-TB genome sequencing: a glimpse of the microbiology of the future. Future Microbiol 2008
Interaction	Regulatory Rv1146	active	aparna.vchalam	2012-10-05
	In vitro transcription assay XZ. Li, L. Zhang et al. Efflux pump-mediated intrinsic drug resistance in Mycobacterium smegmatis. Antimicrob. Agents Chemother. 2004
Interaction	Regulatory Rv1146	active	aparna.vchalam	2012-10-05
	In vitro transcription assay E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv1145	active	aparna.vchalam	2012-10-05
	In vitro transcription assay authors,RR. Scherberger,H. Kaess,S. Brückner [Studies on the action of an anticholinergic agent in combination with a tranquilizer on gastric juice secretion in man]. Arzneimittelforschung 1975
Interaction	Regulatory Rv1145	active	aparna.vchalam	2012-10-05
	In vitro transcription assay authors,NJ. Loman,MJ. Pallen XDR-TB genome sequencing: a glimpse of the microbiology of the future. Future Microbiol 2008
Interaction	Regulatory Rv1145	active	aparna.vchalam	2012-10-05
	In vitro transcription assay XZ. Li, L. Zhang et al. Efflux pump-mediated intrinsic drug resistance in Mycobacterium smegmatis. Antimicrob. Agents Chemother. 2004
Interaction	Regulatory Rv1145	active	aparna.vchalam	2012-10-05
	In vitro transcription assay E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
Interaction	Regulatory Rv1139c	active	anshula.arora1990	2012-10-05
	Co-expression (Functional linkage) authors,B. Karlmark,B. Agerup,PJ. Wistrand Renal proximal tubular acidification. Role of brush-border and cytoplasmic carbonic anhydrase. Acta Physiol. Scand. 1979
Interaction	Regulatory Rv1139c	active	anshula.arora1990	2012-10-05
	Co-expression (Functional linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv1139c	active	anshula.arora1990	2012-10-05
	Co-expression (Functional linkage) authors,JD. Romano,S. Michaelis Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol. Biol. Cell 2001
Interaction	Regulatory Rv1138c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Inhibition Rv0736	active	vmevada102	2012-10-05
	Yeast two-hybrid (Physical interaction) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv0736	active	sourish10	2012-10-05
	Yeast two-hybrid (Physical interaction) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulatory Rv0736	active	ahal4789	2012-10-05
	Yeast two-hybrid (Physical interaction) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Regulates Rv2878c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1660	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1139c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0735	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0735	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008