Rv0763c - ferredoxin

Expression: Most Significant Conditions for Rv0763c

Protein Domains

Gene Information
Locus	Rv0763c
Symbol
Gene Name	ferredoxin
Location	856473 - 856679 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:207 bp Protein:69 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20384
Related Genes	MAP0597c MAV_0707 Mkms_4671 Mmcs_4583 MSMEG_5864 MUL_0472 Mvan_5162 nfa25830
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0763c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0763c Transcript 1
MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQA
LSIRETGE*

Genomic Sequence

>Rv0763c
ATGGGCTATCGAGTCGAAGCCGACCGGGATCTGTGCCAAGGACACGCGATGTGCGAGCTG
GAGGCACCCGAGTATTTCCGGGTGCCCAAGCGCGGCCAGGTCGAAATCCTCGACCCCGAG
CCGCCCGAGGAAGCCCGCGGCGTGATCAAGCATGCCGTGTGGGCCTGTCCCACCCAGGCA
CTGTCCATCCGAGAAACGGGAGAGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Structural Analysis authors,KJ. McLean,AJ. Dunford,R. Neeli,MD. Driscoll,AW. Munro Structure, function and drug targeting in Mycobacterium tuberculosis cytochrome P450 systems. Arch. Biochem. Biophys. 2007
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Structural Analysis A. Bellamine, AT. Mangla et al. Characterization and catalytic properties of the sterol 14alpha-demethylase from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 1999
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Structural Analysis JK. Capyk, R. Kalscheuer et al. Mycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. J. Biol. Chem. 2009
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Structural Analysis KJ. McLean, AJ. Warman et al. Biophysical characterization of the sterol demethylase P450 from Mycobacterium tuberculosis, its cognate ferredoxin, and their interactions. Biochemistry 2006
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Structural Analysis CJ. Jackson, DC. Lamb et al. A novel sterol 14alpha-demethylase/ferredoxin fusion protein (MCCYP51FX) from Methylococcus capsulatus represents a new class of the cytochrome P450 superfamily. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Structural Analysis KJ. McLean, AJ. Dunford et al. CYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. Biochem. Soc. Trans. 2006
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Spectrophotometric authors,KJ. McLean,AJ. Dunford,R. Neeli,MD. Driscoll,AW. Munro Structure, function and drug targeting in Mycobacterium tuberculosis cytochrome P450 systems. Arch. Biochem. Biophys. 2007
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Spectrophotometric A. Bellamine, AT. Mangla et al. Characterization and catalytic properties of the sterol 14alpha-demethylase from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 1999
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Spectrophotometric JK. Capyk, R. Kalscheuer et al. Mycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. J. Biol. Chem. 2009
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Spectrophotometric KJ. McLean, AJ. Warman et al. Biophysical characterization of the sterol demethylase P450 from Mycobacterium tuberculosis, its cognate ferredoxin, and their interactions. Biochemistry 2006
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Spectrophotometric CJ. Jackson, DC. Lamb et al. A novel sterol 14alpha-demethylase/ferredoxin fusion protein (MCCYP51FX) from Methylococcus capsulatus represents a new class of the cytochrome P450 superfamily. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv0764c	active	amit.srcp	2012-10-05
	Spectrophotometric KJ. McLean, AJ. Dunford et al. CYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. Biochem. Soc. Trans. 2006