Rv0827c - transcriptional regulator

Expression: Most Significant Conditions for Rv0827c

Protein Domains

Gene Information
Locus	Rv0827c
Symbol
Gene Name	transcriptional regulator
Location	920741 - 921133 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:393 bp Protein:131 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26647
Related Genes	cg3082 MAP0661c MAV_0776 MT0849 MUL_0448 Mvan_3224 Mvan_3727 Mvan_3728 nfa27680 nfa28340
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0827c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0827c Transcript 1
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQ
HLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSV
AKASATKDVG*

Genomic Sequence

>Rv0827c
ATGTACGCAGATAGTGGACCTGACCCGTTGCCTGACGATCAGGTCTGCTTGGTGGTCGAG
GTGTTCCGAATGCTCGCCGACGCGACCCGCGTGCAGGTGCTGTGGTCGCTGGCAGACCGC
GAAATGTCGGTCAATGAACTCGCCGAGCAGGTGGGCAAGCCCGCGCCGTCGGTCTCCCAG
CACCTGGCAAAGCTACGAATGGCGCGGCTGGTGCGCACCCGCCGCGATGGAACCACGATC
TTTTACCGTCTGGAGAACGAGCACGTGCGCCAGCTCGTCATCGACGCCGTTTTCAACGCC
GAGCACGCCGGTCCCGGGATTCCCCGCCACCACCGTGCTGCCGGCGGACTGCAGTCGGTC
GCTAAGGCATCGGCTACCAAGGATGTCGGGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Activates Rv2025c	active	prabhakarsmail	2012-10-05
	Band Shift DR. Campbell, KE. Chapman et al. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. J. Biol. Chem. 2007
Interaction	Activates Rv2025c	active	akankshajain.21	2012-10-05
	Band Shift DR. Campbell, KE. Chapman et al. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. J. Biol. Chem. 2007
Interaction	Transcription Rv0827c	active	diponlove	2012-10-05
	Co-expression (Functional linkage) DR. Campbell, KE. Chapman et al. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. J. Biol. Chem. 2007
Interaction	Transcription Rv0827c	active	diponlove	2012-10-05
	Co-expression (Functional linkage) DR. Campbell, KE. Chapman et al. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. J. Biol. Chem. 2007
Interaction	Transcription Rv2025c	active	diponlove	2012-10-05
	Co-expression (Functional linkage) DR. Campbell, KE. Chapman et al. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. J. Biol. Chem. 2007
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006