Rv0844c - nitrate/nitrite response transcriptional regulator narL

Expression: Most Significant Conditions for Rv0844c

Protein Domains

Gene Information
Locus	Rv0844c
Symbol	narL
Gene Name	nitrate/nitrite response transcriptional regulator narL
Location	940456 - 941106 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:651 bp Protein:217 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37525
Related Genes	MAP0689c MAV_0872 Mkms_1644 Mmcs_1619 MSMEG_0105 MT0866 MUL_0351 nfa30340 nfa30350
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0844c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0844c Transcript 1
MSNPQPEKVRVVVGDDHPLFREGVVRALSLSGSVNVVGEADDGAAALELIKAHLPDVALL
DYRMPGMDGAQVAAAVRSYELPTRVLLISAHDEPAIVYQALQQGAAGFLLKDSTRTEIVK
AVLDCAKGRDVVAPSLVGGLAGEIRQRAAPVAPVLSAREREVLNRIACGQSIPAIAAELY
VAPSTVKTHVQRLYEKLGVSDRAAAVAEAMRQRLLD*

Genomic Sequence

>Rv0844c
ATGAGCAATCCGCAGCCGGAGAAAGTGCGCGTGGTGGTCGGCGACGACCACCCGTTATTT
CGCGAGGGCGTTGTGCGAGCGCTTTCGTTGAGTGGCTCGGTGAACGTGGTCGGCGAGGCC
GACGACGGCGCCGCGGCCCTGGAGTTGATCAAGGCCCATTTGCCCGACGTCGCATTGCTG
GACTACCGCATGCCCGGCATGGACGGCGCGCAGGTTGCGGCGGCGGTGCGCAGCTACGAG
TTGCCAACCCGGGTGCTGCTTATTTCCGCGCACGACGAGCCGGCGATCGTCTACCAGGCA
CTCCAACAGGGCGCCGCCGGATTCCTGCTCAAGGATTCGACTCGCACCGAGATCGTCAAG
GCGGTGCTCGATTGCGCGAAGGGCCGCGACGTGGTGGCGCCCTCGCTGGTCGGGGGCCTC
GCCGGGGAGATTCGCCAGCGCGCGGCACCCGTGGCCCCGGTGCTCAGCGCGCGCGAGCGC
GAGGTGCTCAATCGCATTGCGTGCGGTCAAAGCATCCCCGCGATCGCAGCCGAGCTATAT
GTGGCGCCGTCGACGGTAAAGACCCACGTGCAACGGTTGTACGAGAAGCTCGGCGTCAGC
GACCGAGCTGCCGCGGTCGCCGAGGCGATGCGGCAGAGGCTGCTCGACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv0845	active	hibeeluck	2012-10-05
	Gene neighbourhood T. Parish, DA. Smith et al. Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis. Infect. Immun. 2003
Interaction	Regulates Rv3547	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1677	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0529	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3547	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1677	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0529	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006