Rv0937c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0937c

Protein Domains

Gene Information
Locus	Rv0937c
Symbol
Gene Name	conserved hypothetical protein
Location	1045199 - 1046020 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:822 bp Protein:274 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	24893
Related Genes	MAP0875c MAV_1050 Mkms_4447 Mmcs_4361 MSMEG_5580 MT0964 MUL_4436 Mvan_4917 nfa34910
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0937c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0937c Transcript 1
MRAIWTGSIAFGLVNVPVKVYSATADHDIRFHQVHAKDNGRIRYKRVCEACGEVVDYRDL
ARAYESGDGQMVAITDDDIASLPEERSREIEVLEFVPAADVDPMMFDRSYFLEPDSKSSK
SYVLLAKTLAETDRMAIVHFTLRNKTRLAALRVKDFGKREVMMVHTLLWPDEIRDPDFPV
LDQKVEIKPAELKMAGQVVDSMADDFNPDRYHDTYQEQLQELIDTKLEGGQAFTAEDQPR
LLDEPEDVSDLLAKLEASVKARSKANSNVPTPP*

Genomic Sequence

>Rv0937c
ATGCGAGCCATTTGGACGGGTTCGATCGCCTTCGGGCTGGTGAACGTGCCGGTCAAGGTG
TACAGCGCTACCGCAGACCACGACATCAGGTTCCACCAGGTGCACGCCAAGGACAACGGA
CGCATCCGGTACAAGCGCGTCTGCGAGGCGTGTGGCGAGGTGGTCGACTACCGCGATCTT
GCCCGGGCCTACGAGTCCGGCGACGGCCAAATGGTGGCGATCACCGACGACGACATCGCC
AGCTTGCCTGAAGAACGCAGCCGGGAGATCGAGGTGTTGGAGTTCGTCCCCGCCGCCGAC
GTGGACCCGATGATGTTCGACCGCAGCTACTTTTTGGAGCCTGATTCGAAGTCGTCGAAA
TCGTATGTGCTGCTGGCTAAGACACTCGCCGAGACCGACCGGATGGCGATCGTGCATTTC
ACGCTGCGCAACAAGACCAGGCTGGCGGCGTTGCGCGTCAAGGATTTCGGCAAGCGAGAG
GTGATGATGGTGCACACGTTGCTGTGGCCCGATGAGATCCGCGACCCCGACTTCCCGGTG
CTGGACCAGAAGGTGGAGATCAAACCCGCGGAACTCAAGATGGCCGGCCAGGTGGTGGAC
TCGATGGCCGACGACTTCAATCCGGACCGCTACCACGACACCTACCAGGAGCAGTTACAG
GAGCTGATCGACACCAAACTCGAAGGTGGGCAGGCATTTACCGCCGAGGACCAACCGAGG
TTGCTGGACGAGCCCGAAGACGTCTCCGACCTGCTCGCCAAGCTGGAGGCCAGCGTGAAG
GCGCGCTCGAAGGCCAACTCAAACGTCCCAACGCCTCCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) authors,C. Gong,P. Bongiorno,A. Martins,NC. Stephanou,H. Zhu,S. Shuman,MS. Glickman Mechanism of nonhomologous end-joining in mycobacteria: a low-fidelity repair system driven by Ku, ligase D and ligase C. Nat. Struct. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) authors,RS. Pitcher,LM. Tonkin,AJ. Green,AJ. Doherty Domain structure of a NHEJ DNA repair ligase from Mycobacterium tuberculosis. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) KM. Sinha, NC. Stephanou et al. Mycobacterial UvrD1 is a Ku-dependent DNA helicase that plays a role in multiple DNA repair events, including double-strand break repair. J. Biol. Chem. 2007
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) authors,D. Akey,A. Martins,J. Aniukwu,MS. Glickman,S. Shuman,JM. Berger Crystal structure and nonhomologous end-joining function of the ligase component of Mycobacterium DNA ligase D. J. Biol. Chem. 2006
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) authors,C. Gong,P. Bongiorno,A. Martins,NC. Stephanou,H. Zhu,S. Shuman,MS. Glickman Mechanism of nonhomologous end-joining in mycobacteria: a low-fidelity repair system driven by Ku, ligase D and ligase C. Nat. Struct. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) authors,RS. Pitcher,LM. Tonkin,AJ. Green,AJ. Doherty Domain structure of a NHEJ DNA repair ligase from Mycobacterium tuberculosis. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) KM. Sinha, NC. Stephanou et al. Mycobacterial UvrD1 is a Ku-dependent DNA helicase that plays a role in multiple DNA repair events, including double-strand break repair. J. Biol. Chem. 2007
Interaction	PhysicalInteraction Rv0938	active	aparna.vchalam	2012-10-05
	Yeast two-hybrid (Physical interaction) authors,RS. Pitcher,LM. Tonkin,JM. Daley,PL. Palmbos,AJ. Green,TL. Velting,A. Brzostek,M. Korycka-Machala,S. Cresawn,J. Dziadek,GF. Hatfull,TE. Wilson,AJ. Doherty Mycobacteriophage exploit NHEJ to facilitate genome circularization. Mol. Cell 2006
Other	TBPWY:Non-homologous end-joining	active	vmizrahi	2012-03-05
	LigD consists of a C-terminal ATP-dependent ligase domain fused to upstream polymerase and phosphoesterase modules. Catalyses DSB repair via non-homologous end-joining (NHEJ) with DNA ligase D (LigD)
Symbol	ku	active	vmizrahi	2012-03-05
	LigD consists of a C-terminal ATP-dependent ligase domain fused to upstream polymerase and phosphoesterase modules. Catalyses DSB repair via non-homologous end-joining (NHEJ) with DNA ligase D (LigD)