Rv0967 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv0967

Protein Domains

Gene Information
Locus	Rv0967
Symbol
Gene Name	conserved hypothetical protein
Location	1077975 - 1078334 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:360 bp Protein:120 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20457
Related Genes	CE0057 cg0075 DIP1749 Mkms_4092 Mmcs_4017 MT0995 MUL_0425 nfa41000
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv0967
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv0967 Transcript 1
MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHN
HLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLGGAAVGESATEEPMPDASNM*

Genomic Sequence

>Rv0967
ATGAGCAAGGAATTGACCGCAAAGAAGCGCGCGGCGCTGAACCGGCTGAAGACGGTTCGG
GGCCATCTTGACGGAATCGTTCGGATGCTGGAGTCCGACGCCTACTGCGTGGACGTGATG
AAGCAGATTTCAGCGGTTCAGTCCTCGCTGGAGCGGGCCAACCGGGTGATGCTGCACAAC
CACTTGGAGACGTGCTTTTCCACGGCGGTGCTGGATGGTCATGGGCAAGCGGCCATCGAA
GAGCTCATTGATGCCGTCAAATTCACGCCGGCGCTGACCGGTCCACACGCGCGGCTCGGC
GGTGCCGCGGTCGGCGAGTCGGCCACCGAGGAGCCGATGCCGGATGCCAGCAACATGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0970	active	raj252000	2012-10-05
	Co-expression (Functional linkage) PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	Regulatory Rv0970	active	raj252000	2012-10-05
	Co-expression (Functional linkage) authors,AM. Talaat,R. Lyons,ST. Howard,SA. Johnston The temporal expression profile of Mycobacterium tuberculosis infection in mice. Proc. Natl. Acad. Sci. U.S.A. 2004
Interaction	Regulatory Rv0970	active	raj252000	2012-10-05
	Co-expression (Functional linkage) AM. Talaat, SK. Ward et al. Mycobacterial bacilli are metabolically active during chronic tuberculosis in murine lungs: insights from genome-wide transcriptional profiling. J. Bacteriol. 2007
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulates Rv0970	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	Regulates Rv0969	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	Regulates Rv0968	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	RegulatedBy Rv0967	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	Regulates Rv0967	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	RegulatedBy Rv0967	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	Regulates Rv0967	active	yamir.moreno	2012-10-05
	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
Interaction	Regulates Rv0969	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0968	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0967	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0967	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008