Rv1142c - enoyl-CoA hydratase echA10

Expression: Most Significant Conditions for Rv1142c

Protein Domains

Gene Information
Locus	Rv1142c
Symbol	echA10
Gene Name	enoyl-CoA hydratase echA10
Location	1269152 - 1269958 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:807 bp Protein:269 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30456
Related Genes	MAP2639 MAV_1283 Mkms_4145 Mmcs_4070 MSMEG_5185 MT1174 MT1175 MUL_0985 Mvan_4579 Rv1141c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1142c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1142c Transcript 1
MSNYRIDTRTIVPGLAVTLADGVLSVTIDRPESLNSLTKPVLAGMADAIEGAATDPRVKV
VRLGGAGRGFSSGGAISVDDVWASGPPTDTVAEANRTVRAIVALPQPVVAVVQGPTVGCG
VSLALACDLVLASDNAFFMLAHTNVGLMPDGGASALVQAAIGRIRAMHMALLPDRVPAAE
ALSWGLVSAVYPAADFDAEVDKLISRLLAGPALAIAKTKNAINAATLTELAPTLLRELDG
QALLLRTDDFAEGATAFQQRRTPMFTGR*

Genomic Sequence

>Rv1142c
ATGTCGAACTACCGGATCGACACTCGGACAATTGTCCCGGGTCTCGCCGTCACCCTGGCC
GACGGGGTGCTGTCGGTGACCATCGATCGCCCGGAGAGTCTCAACTCGCTGACCAAGCCG
GTGCTGGCAGGGATGGCCGACGCGATCGAGGGCGCGGCCACCGACCCACGGGTGAAGGTG
GTGCGCCTCGGGGGCGCCGGTCGCGGCTTCAGCTCCGGAGGGGCAATCAGCGTTGACGAT
GTGTGGGCCAGTGGCCCGCCTACCGACACCGTCGCGGAGGCCAACCGCACGGTGCGTGCC
ATTGTGGCACTACCACAACCGGTCGTTGCCGTCGTGCAGGGACCAACCGTCGGCTGTGGC
GTCTCCCTGGCGCTCGCTTGTGACCTCGTATTGGCCTCCGACAATGCGTTTTTCATGCTC
GCTCACACCAACGTGGGGTTGATGCCCGACGGCGGCGCGTCGGCGTTGGTTCAGGCCGCG
ATCGGCCGCATCCGCGCCATGCATATGGCGCTGCTGCCGGACCGGGTGCCGGCCGCCGAG
GCCTTGTCCTGGGGCCTGGTCAGCGCCGTCTATCCGGCCGCCGACTTCGATGCCGAGGTG
GACAAGTTGATCTCACGGCTGTTGGCCGGCCCAGCGCTGGCTATCGCCAAGACGAAGAAC
GCGATCAATGCGGCCACGCTCACCGAGTTGGCACCCACTCTCCTGCGCGAATTGGATGGC
CAGGCCCTCCTCCTGCGTACTGACGACTTCGCCGAGGGCGCAACGGCATTCCAGCAGCGC
CGGACCCCCATGTTCACCGGCCGTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Name	Putative 2-trans-Enoyl-ACP isomerase	active	mjackson	2012-10-05
	FAS-II
Term	EC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.16 Acetyl-CoA C-acyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:1.1.1.35 3-hydroxyacyl-CoA dehydrogenase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:4.2.1.17 Enoyl-CoA hydratase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:1.3.99.3 Acyl-CoA dehydrogenase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.17 Aspartate N-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.18 Galactoside O-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.19 Phosphate butyryltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.20 Diacylglycerol O-acyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.21 Carnitine O-palmitoyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.22 2-acylglycerol O-acyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.23 1-acylglycerophosphocholine O-acyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.24 Sphingosine N-acyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.25 Plasmalogen synthase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.26 Sterol O-acyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.27 Cortisol O-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.28 Chloramphenicol O-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.29 Glycine C-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.30 Serine O-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005