Rv1224 - hypothetical protein tatB

Expression: Most Significant Conditions for Rv1224

Protein Domains

Gene Information
Locus	Rv1224
Symbol	tatB
Gene Name	hypothetical protein tatB
Location	1367463 - 1367858 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:396 bp Protein:132 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	471
Related Genes	Acel_0601 CE1180 cg1273 DIP0996 jk1378 MAP2554c MAV_1367 Mkms_4065 ML1079 Mmcs_3991 MSMEG_5069 MT1262 MUL_4516 Mvan_4493 nfa47320 PPA0643 SAV3114 SCO5150
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1224
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1224 Transcript 1
MFANIGWWEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFD
DLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRPTPKKPDAAGSAGPDATEQIG
AGPIPFDSDAT*

Genomic Sequence

>Rv1224
GTGTTCGCCAACATCGGTTGGTGGGAAATGCTCGTCCTCGTCATGGTCGGGCTGGTGGTG
CTTGGCCCGGAGCGGCTCCCGGGTGCCATCCGCTGGGCGGCAAGCGCTCTGCGGCAGGCG
CGCGACTATCTCAGCGGTGTGACCAGCCAGCTACGTGAGGACATTGGACCCGAATTCGAT
GATCTGCGGGGACATCTCGGTGAGCTGCAGAAGCTACGGGGAATGACTCCGCGGGCTGCG
TTGACCAAGCACCTACTGGATGGCGATGATTCCCTGTTCACCGGAGACTTCGACCGACCG
ACGCCGAAGAAACCGGATGCGGCGGGCTCGGCGGGGCCGGACGCTACTGAGCAGATCGGT
GCGGGGCCCATCCCGTTTGACAGCGATGCCACCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv2093c	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	Operon Rv2094c	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	Operon Rv2093c	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Interaction	Operon Rv2094c	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Interaction	Operon Rv2093c	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	Operon Rv2094c	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv2068c	active	gaat3s	2012-10-05
	Spectrophotometric Analysis JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2068c	active	gaat3s	2012-10-05
	Spectrophotometric Analysis authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Interaction	PhysicalInteraction Rv2068c	active	gaat3s	2012-10-05
	Spectrophotometric Analysis JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006