Rv1237 - sugar-transport membrane protein ABC transporter sugB

Expression: Most Significant Conditions for Rv1237

Protein Domains

Gene Information
Locus	Rv1237
Symbol	sugB
Gene Name	sugar-transport membrane protein ABC transporter sugB
Location	1379855 - 1380679 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:825 bp Protein:275 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	38062
Related Genes	MAP2546c MAV_1376 Mkms_4055 ML1088 Mmcs_3981 MSMEG_5059 MT1275 MUL_4511 Mvan_2542
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1237
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1237 Transcript 1
MGARRATYWAVLDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTFDNYRGIFRGD
LFSSALINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKRLLIGAALLITMFPSISLVTP
LFNIERAIGLFDTWPGLILPYITFALPLAIYTLSAFFREIPWDLEKAAKMDGATPGQAFR
KVIVPLAAPGLVTAAILVFIFAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGS
IAAGAIVITIPIIVFVLIFQRRIVAGLTSGAVKG*

Genomic Sequence

>Rv1237
GTGGGCGCGCGGCGCGCCACGTATTGGGCCGTCCTGGACACTTTGGTCGTGGGGTACGCG
TTGCTCCCGGTGCTGTGGATTTTCAGCCTGTCACTCAAGCCGACGTCAACGGTCAAGGAC
GGCAAGCTGATTCCGTCGACGGTGACTTTCGACAACTATCGTGGCATCTTCCGGGGCGAC
TTGTTCAGCTCAGCGCTGATCAACTCCATCGGAATCGGCCTGATCACCACCGTGATCGCG
GTGGTGCTCGGCGCGATGGCGGCCTACGCGGTTGCCCGGCTGGAATTTCCGGGCAAGCGG
CTGCTAATCGGGGCTGCCTTGCTGATCACGATGTTCCCGTCGATCTCTTTGGTCACACCA
TTGTTCAACATCGAACGTGCCATCGGCCTGTTCGACACCTGGCCGGGGTTGATCTTGCCG
TACATCACCTTCGCGTTGCCGCTCGCGATCTACACCCTGTCGGCGTTCTTCCGGGAGATC
CCTTGGGATCTGGAAAAGGCGGCCAAGATGGACGGTGCAACGCCCGGTCAGGCTTTCCGG
AAGGTGATCGTACCGCTGGCGGCGCCGGGCTTGGTGACCGCTGCAATCCTGGTGTTCATT
TTCGCCTGGAACGATCTGCTGCTCGCGTTGTCGCTGACCGCTACCAAGGCGGCGATTACC
GCGCCGGTGGCCATCGCCAACTTCACCGGCAGTTCGCAATTCGAGGAGCCGACCGGCTCG
ATCGCGGCCGGCGCGATCGTGATTACGATCCCGATCATCGTCTTTGTTTTAATCTTCCAA
CGACGGATTGTCGCCGGGTTGACCTCTGGCGCTGTGAAGGGATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv1238	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1238	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1238	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1238	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1236	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,J. Rengarajan,BR. Bloom,EJ. Rubin Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	Operon Rv1235	active	harsharohiratruefriend	2012-10-05
	Gene-Neighborhood authors,CM. Sassetti,EJ. Rubin Genetic requirements for mycobacterial survival during infection. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3080c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv3080c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006