Rv1246c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1246c

Protein Domains

Gene Information
Locus	Rv1246c
Symbol
Gene Name	conserved hypothetical protein
Location	1388685 - 1388978 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:294 bp Protein:98 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11550
Related Genes	MT1284
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1246c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1246c Transcript 1
MSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSAR
RGDYRVVYAIDDGHHRVEIIHIARRSASYRMNPCRPR*

Genomic Sequence

>Rv1246c
GTGAGCGACGACCATCCCTACCACGTGGCGATCACCGCGACAGCGGCACGCGACCTGCAA
CGCTTACCCGAAAAGATCGCCGCCGCATGTGTCGAGTTTGTTTTCGGACCGCTGCTTAAC
AACCCGCATAGGTTGGGCAAGCCGCTGCGCAATGACCTTGAAGGCCTCCACTCAGCCCGC
CGCGGTGATTACCGCGTCGTCTACGCCATCGACGACGGCCACCACCGAGTCGAGATCATC
CACATCGCTCGTCGCAGTGCCAGCTACCGAATGAACCCGTGCCGGCCACGTTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2053c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	Regulatory Rv2052c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	InhibitedBy Rv1247c	active	aparna.vchalam	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	InhibitedBy Rv1247c	active	aparna.vchalam	2012-10-05
	Affinity purification (Physical interaction) ZL. Shang, L. Bao et al. [Protein-protein interaction between hypothetical protein Rv1246c and Rv1247c of Mycobacterium tuberculosis] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
Interaction	InhibitedBy Rv1247c	active	aparna.vchalam	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	InhibitedBy Rv1247c	active	aparna.vchalam	2012-10-05
	Affinity purification (Physical interaction) ZL. Shang, L. Bao et al. [Protein-protein interaction between hypothetical protein Rv1246c and Rv1247c of Mycobacterium tuberculosis] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
Symbol	relE	active	jlew	2012-03-07
	Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
Symbol	relE1	active	jlew	2012-03-07
	Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin. authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Symbol	relE	active	jlew	2012-03-07
	relB and relE interact directly. Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Symbol	RelE1	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap)
Other	stop:1388978	active	rslayden	2012-03-05
	MTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap)
Other	start:1388685	active	rslayden	2012-03-05
	MTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to Rv2866
Other	stop:1388978	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to Rv2866
Other	start:1388685	active	rslayden	2012-03-05
	Conserved hypothetical protein, highly similar to Rv2866