Rv1281c - oligopeptide-transport ATP-binding protein ABC transporter oppD

Expression: Most Significant Conditions for Rv1281c

Protein Domains

Gene Information
Locus	Rv1281c
Symbol	oppD
Gene Name	oligopeptide-transport ATP-binding protein ABC transporter oppD
Location	1433433 - 1435271 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1839 bp Protein:613 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37613
Related Genes	MAP2490 MAV_1431 Mkms_4004 ML1122 Mmcs_3930 MSMEG_4997 MT1318 MUL_4001 Mvan_4432 nfa1670
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1281c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1281c Transcript 1
MSPLLEVTDLAVTFRTDGDPVTAVRGISYRVEPGEVVAMVGESGSGKSAAAMAVVGLLPE
YAQVRGSVRLQGTELLGLADNAMSRFRGKAIGTVFQDPMSALTPVYTVGDQIAEAIEVHQ
PRVGKKAARRRAVELLDLVGISQPQRRSRAFPHELSGGERQRVVIAIAIANDPDLLICDE
PTTALDVTVQAQILDVLKAARDVTGAGVLIITHDLGVVAEFADRALVMYAGRVVESAGVN
DLYRDRRMPYTVGLLGSVPRLDAAQGTRLVPIPGAPPSLAGLAPGCPFAPRCPLVIDECL
TAEPELLDVATDHRAACIRTELVTGRSAADIYRVKTEARPAALGDASVVVRVRHLVKTYR
LAKGVVLRRAIGEVRAVDGISLELRQGRTLGIVGESGSGKSTTLHEILELAAPQSGSIEV
LGTDVATLGTAERRSLRRDIQVVFQDPVASLDPRLPVFDLIAEPLQANGFGKNETHARVA
ELLDIVGLRHGDASRYPAEFSGGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIIN
LLLDLQEQFGLSYLFVSHDLSVVKHLAHQVAVMLAGTVVEQGDSEEVFGNPKHEYTRRLL
GAVPQPDPARRG*

Genomic Sequence

>Rv1281c
ATGAGCCCCCTGCTCGAGGTGACCGATTTGGCCGTCACCTTCAGGACCGATGGCGATCCG
GTGACCGCGGTGCGCGGGATCAGCTACCGCGTCGAGCCCGGCGAGGTGGTCGCGATGGTG
GGCGAATCGGGTTCAGGTAAGTCCGCAGCGGCGATGGCGGTGGTGGGCCTGCTGCCCGAG
TACGCGCAGGTGCGTGGTTCGGTTCGGCTACAGGGTACCGAACTGTTGGGGCTTGCCGAC
AACGCGATGTCCCGGTTTCGAGGCAAGGCGATCGGCACGGTGTTCCAGGATCCGATGTCT
GCGCTCACCCCTGTCTACACCGTCGGCGACCAAATCGCCGAGGCCATCGAGGTGCACCAG
CCCCGTGTTGGCAAGAAGGCCGCTCGTCGGCGTGCGGTGGAACTGCTTGACCTGGTCGGT
ATTTCGCAGCCGCAGCGGCGTTCCCGTGCGTTTCCGCATGAGCTTTCAGGTGGCGAACGC
CAACGCGTGGTGATCGCCATCGCGATCGCCAACGATCCCGACCTGTTGATCTGTGACGAA
CCGACCACGGCGCTCGACGTCACGGTGCAGGCGCAGATCCTCGACGTCCTCAAGGCGGCG
CGCGACGTCACCGGCGCCGGGGTGCTGATCATCACCCACGACCTCGGCGTCGTGGCCGAG
TTCGCCGACCGGGCGCTGGTGATGTACGCCGGACGGGTCGTCGAGTCGGCCGGGGTGAAT
GATCTGTACCGCGATCGCCGGATGCCCTACACCGTGGGGCTTTTAGGCTCGGTCCCCCGG
CTGGATGCCGCGCAGGGCACCCGGCTGGTGCCGATACCGGGTGCGCCCCCGTCGCTGGCG
GGCTTGGCACCGGGTTGCCCGTTCGCGCCGCGCTGCCCGCTAGTCATCGACGAATGCCTT
ACCGCGGAACCCGAATTGCTTGACGTCGCTACCGATCACCGGGCGGCCTGCATCCGCACC
GAGCTGGTCACCGGGCGCAGCGCCGCCGACATCTACCGGGTCAAAACCGAGGCCCGCCCG
GCTGCACTCGGCGACGCCTCGGTGGTCGTGCGGGTACGTCATCTAGTCAAAACCTACCGG
CTGGCCAAGGGCGTGGTGCTGCGCCGGGCGATCGGCGAGGTCCGCGCGGTCGACGGCATC
AGTCTCGAACTCCGGCAGGGCCGCACGTTGGGTATCGTCGGCGAATCCGGTTCGGGCAAG
TCGACCACCCTGCACGAGATCCTGGAGCTGGCTGCGCCGCAATCGGGATCGATCGAAGTC
CTCGGCACTGACGTCGCCACGCTGGGGACAGCGGAACGCCGATCGCTGCGCCGCGACATC
CAGGTGGTCTTCCAAGACCCGGTGGCGTCCTTAGACCCGCGGCTGCCGGTCTTCGATCTG
ATTGCCGAACCATTGCAGGCCAATGGGTTCGGCAAGAACGAGACTCACGCGCGGGTCGCC
GAGCTGCTCGATATCGTCGGACTGCGCCACGGCGACGCCAGTCGTTATCCCGCCGAGTTC
TCCGGCGGTCAGAAGCAGCGCATCGGCATCGCGCGGGCACTGGCGCTCCAACCCAAGATC
CTGGCACTCGACGAACCGGTGTCGGCACTCGATGTCTCCATTCAGGCCGGGATCATCAAC
CTGCTGCTCGACCTCCAAGAGCAGTTCGGGTTGTCATATTTATTTGTTTCCCACGATCTT
TCGGTGGTCAAACACCTCGCCCACCAGGTGGCGGTCATGCTTGCCGGTACCGTTGTTGAG
CAGGGCGACAGTGAGGAGGTCTTCGGCAATCCGAAACACGAGTACACCAGGCGACTGCTG
GGCGCGGTACCGCAACCGGATCCGGCCCGTCGTGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1283c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006