Rv1283c - oligopeptide-transport membrane protein ABC transporter oppB

Expression: Most Significant Conditions for Rv1283c

Protein Domains

Gene Information
Locus	Rv1283c
Symbol	oppB
Gene Name	oligopeptide-transport membrane protein ABC transporter oppB
Location	1436140 - 1437117 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:978 bp Protein:326 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37761
Related Genes	MAP2488 MAV_1433 Mkms_4002 ML1124 Mmcs_3928 MSMEG_4995 MT1320 MUL_3999 Mvan_4430 nfa1690
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1283c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1283c Transcript 1
MTRYLARRLLNYLVLLALASFLTYCLTSLAFSPLESLMQRSPRPPQAVIDAKAHDLGLDR
PILARYANWVSHAVRGDFGTTITGQPVGTELGRRIGVSLRLLVVGSVFGTVAGVVIGAWG
AIRQYRLSDRVMTTLALLVLSTPTFVVANLLILGALRVNWAVGIQLFDYTGETSPGVAGG
VWDRLGDRLQHLILPSLTLALAAAAGFSRYQRNAMLDVLGQDFIRTARAKGLTRRRALLK
HGLRTALIPMATLFAYGVAGLVTGAVFVEKIFGWHGMGEWMVRGISTQDTNIVAAITVFS
GAVVLLAGLLSDVIYAALDPRVRVS*

Genomic Sequence

>Rv1283c
ATGACGCGCTATCTGGCCCGCCGGTTGCTCAACTACCTGGTGCTGCTGGCGCTGGCGTCG
TTTTTGACGTACTGCCTGACCTCGCTGGCGTTCTCGCCGCTGGAAAGCCTGATGCAACGC
AGTCCGCGCCCACCGCAAGCGGTTATCGATGCCAAGGCACACGATCTCGGCTTGGACAGA
CCCATACTGGCCCGCTACGCCAACTGGGTATCGCATGCCGTCCGTGGCGACTTCGGAACC
ACCATCACCGGCCAGCCTGTCGGTACCGAACTGGGGCGCCGGATCGGAGTCAGCCTGCGG
CTGCTGGTCGTTGGATCGGTATTCGGCACGGTGGCCGGTGTGGTGATCGGGGCGTGGGGT
GCCATCCGGCAGTACCGGCTCAGCGACCGCGTCATGACCACGCTGGCGCTGCTGGTGTTG
AGCACACCGACGTTTGTGGTGGCCAACCTGTTGATCCTGGGCGCCCTGCGGGTCAACTGG
GCAGTGGGCATCCAGCTTTTCGACTACACCGGGGAGACGTCACCCGGCGTTGCCGGCGGG
GTGTGGGATCGGCTAGGCGACCGGTTGCAGCATTTGATCCTGCCATCGCTGACGTTGGCG
CTGGCGGCCGCCGCCGGGTTCAGCCGCTACCAGCGCAACGCGATGCTGGATGTCCTCGGC
CAGGATTTCATTCGCACCGCCCGCGCCAAGGGGCTGACCCGACGACGGGCCCTACTCAAG
CATGGCCTGCGAACGGCGCTAATACCGATGGCCACGCTGTTCGCCTACGGGGTGGCCGGG
TTGGTCACCGGAGCGGTTTTCGTCGAGAAGATCTTCGGCTGGCACGGCATGGGTGAATGG
ATGGTCCGCGGTATCTCGACTCAGGACACCAACATCGTCGCGGCAATTACCGTGTTCTCC
GGCGCGGTCGTGTTGCTGGCCGGTTTGCTCTCGGACGTGATCTACGCGGCTTTGGACCCG
AGGGTACGGGTGTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1282c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1281c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) MA. Flores-Valdez,RP. Morris,F. Laval,M. Daffé,GK. Schoolnik Mycobacterium tuberculosis modulates its cell surface via an oligopeptide permease (Opp) transport system. FASEB J. 2009
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,YK. Dayaram,MT. Talaue,ND. Connell,V. Venketaraman Characterization of a glutathione metabolic mutant of Mycobacterium tuberculosis and its resistance to glutathione and nitrosoglutathione. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1280c	active	swetha.r	2012-10-05
	Operon (Functional linkage) RM. Green, A. Seth et al. A peptide permease mutant of Mycobacterium bovis BCG resistant to the toxic peptides glutathione and S-nitrosoglutathione. Infect. Immun. 2000