Rv1304 - ATP synthase A chain atpB

Expression: Most Significant Conditions for Rv1304

Protein Domains

Gene Information
Locus	Rv1304
Symbol	atpB
Gene Name	ATP synthase A chain atpB
Location	1460244 - 1460996 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:753 bp Protein:251 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	24698
Related Genes	Acel_0647 BL0363 CE1309 cg1362 DIP1046 jk1341 MAP2457c MAV_1521 Mkms_3956 ML1139 Mmcs_3882 MSMEG_4942 MT1344 MUL_3960 Mvan_4334 nfa10590 PPA1245 SAV2887
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1304
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1304 Transcript 1
MTETILAAQIEVGEHHTATWLGMTVNTDTVLSTAIAGLIVIALAFYLRAKVTSTDVPGGV
QLFFEAITIQMRNQVESAIGMRIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHGHTTE
LLKSAAADINYVLALALFVFVCYHTAGIWRRGIVGHPIKLLKGHVTLLAPINLVEEVAKP
ISLSLRLFGNIFAGGILVALIALFPPYIMWAPNAIWKAFDLFVGAIQAFIFALLTILYFS
QAMELEEEHH*

Genomic Sequence

>Rv1304
ATGACTGAGACCATCCTGGCCGCCCAAATCGAGGTCGGCGAGCACCACACGGCCACCTGG
CTCGGTATGACGGTCAACACCGACACCGTGTTGTCGACGGCGATCGCCGGGTTGATCGTG
ATCGCGTTGGCCTTTTACCTGCGCGCCAAAGTGACTTCGACGGATGTGCCAGGCGGGGTG
CAGTTGTTTTTTGAGGCGATCACCATTCAGATGCGCAATCAGGTCGAAAGCGCCATCGGG
ATGCGGATCGCACCCTTCGTGCTGCCGCTGGCGGTGACCATCTTCGTGTTCATCCTGATC
TCCAACTGGCTGGCAGTCCTCCCGGTGCAGTACACCGATAAACACGGGCACACCACCGAG
TTGCTCAAATCGGCAGCAGCGGACATCAATTACGTGCTGGCGCTGGCGCTTTTCGTGTTC
GTCTGCTACCACACGGCCGGTATTTGGCGGCGCGGTATTGTCGGACACCCGATCAAGTTG
CTGAAAGGGCACGTGACGCTCCTCGCGCCGATCAACCTTGTCGAAGAAGTCGCCAAGCCA
ATCTCGTTGTCGCTCCGACTTTTCGGCAACATTTTCGCCGGCGGCATTCTGGTCGCACTG
ATCGCGCTCTTTCCCCCCTACATCATGTGGGCGCCCAATGCGATCTGGAAAGCATTTGAC
CTGTTCGTCGGCGCAATCCAGGCCTTCATTTTTGCGCTGCTGACAATTTTGTACTTCAGC
CAAGCGATGGAGCTCGAAGAGGAACACCACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1305	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001