Rv1305 - ATP synthase C chain atpE

Expression: Most Significant Conditions for Rv1305

Protein Domains

Gene Information
Locus	Rv1305
Symbol	atpE
Gene Name	ATP synthase C chain atpE
Location	1461045 - 1461290 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:246 bp Protein:82 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6693
Related Genes	Acel_0648 MAP2456c MAV_1522 Mkms_3955 ML1140 Mmcs_3881 MSMEG_4941 MT1345 MUL_3959 Mvan_4333
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1305
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1305 Transcript 1
MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV
EAAYFINLAFMALFVFATPVK*

Genomic Sequence

>Rv1305
ATGGACCCCACTATCGCTGCCGGCGCCCTCATCGGCGGTGGACTGATCATGGCCGGTGGC
GCCATCGGCGCCGGTATCGGTGACGGTGTCGCCGGTAACGCGCTTATCTCCGGTGTCGCC
CGGCAACCCGAGGCGCAAGGGCGGCTGTTCACACCGTTCTTCATCACCGTCGGTTTGGTT
GAGGCGGCATACTTCATCAACCTGGCGTTTATGGCGCTGTTCGTCTTCGCTACACCCGTC
AAGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy authors,M. Rappas,H. Niwa,X. Zhang Mechanisms of ATPases--a multi-disciplinary approach. Curr. Protein Pept. Sci. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1306	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	structural analysis authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy MR. de Jonge, LH. Koymans et al. A computational model of the inhibition of Mycobacterium tuberculosis ATPase by a new drug candidate R207910. Proteins 2007
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
Interaction	PhysicalInteraction Rv1304	active	priti.priety	2012-10-05
	spectrophotometric assy authors,RJ. Carbajo,FA. Kellas,MJ. Runswick,MG. Montgomery,JE. Walker,D. Neuhaus Structure of the F1-binding domain of the stator of bovine F1Fo-ATPase and how it binds an alpha-subunit. J. Mol. Biol. 2005
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006