Rv1308 - ATP synthase alpha chain atpA

Expression: Most Significant Conditions for Rv1308

Protein Domains

Gene Information
Locus	Rv1308
Symbol	atpA
Gene Name	ATP synthase alpha chain atpA
Location	1463228 - 1464877 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1650 bp Protein:550 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	516
Related Genes	Acel_0651 BL0359 CE1313 cg1366 DIP1050 jk1337 MAP2453c MAV_1525 Mkms_3952 ML1143 Mmcs_3878 MSMEG_4938 MT1348 MUL_3956 Mvan_4330 nfa10630 PPA1241 SAV2883
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1308
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1308 Transcript 1
MAELTIPADDIQSAIEEYVSSFTADTSREEVGTVVDAGDGIAHVEGLPSVMTQELLEFPG
GILGVALNLDEHSVGAVILGDFENIEEGQQVKRTGEVLSVPVGDGFLGRVVNPLGQPIDG
RGDVDSDTRRALELQAPSVVHRQGVKEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA
VCVDTILNQRQNWESGDPKKQVRCVYVAIGQKGTTIAAVRRTLEEGGAMDYTTIVAAAAS
ESAGFKWLAPYTGSAIAQHWMYEGKHVLIIFDDLTKQAEAYRAISLLLRRPPGREAYPGD
VFYLHSRLLERCAKLSDDLGGGSLTGLPIIETKANDISAYIPTNVISITDGQCFLETDLF
NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ
LERGARLVELLKQPQSQPMPVEEQVVSIFLGTGGHLDSVPVEDVRRFETELLDHMRASEE
EILTEIRDSQKLTEEAADKLTEVIKNFKKGFAATGGGSVVPDEHVEALDEDKLAKEAVKV
KKPAPKKKK*

Genomic Sequence

>Rv1308
ATGGCTGAGTTGACAATCCCCGCTGATGACATCCAGAGCGCAATCGAAGAGTACGTAAGC
TCTTTCACCGCCGACACCAGTAGAGAGGAAGTCGGTACCGTCGTCGATGCCGGGGACGGC
ATCGCACACGTCGAGGGTTTGCCATCGGTGATGACCCAAGAGCTGCTCGAATTCCCGGGC
GGAATCCTCGGCGTCGCCCTCAACCTCGACGAGCACAGCGTCGGCGCGGTGATCCTCGGT
GACTTCGAGAACATCGAAGAAGGTCAGCAGGTCAAGCGCACCGGCGAAGTCTTATCGGTT
CCGGTTGGCGACGGGTTTTTGGGGCGGGTGGTTAACCCGCTCGGCCAGCCGATCGACGGG
CGCGGAGACGTCGACTCCGATACTCGGCGCGCGCTGGAGCTCCAGGCGCCCTCGGTGGTG
CACCGGCAAGGCGTGAAGGAGCCGTTGCAGACCGGGATCAAGGCGATTGACGCGATGACC
CCGATCGGCCGCGGCCAGCGCCAGCTGATCATCGGCGACCGCAAGACCGGCAAAACCGCC
GTCTGCGTCGACACCATCCTCAACCAGCGGCAGAACTGGGAGTCCGGTGATCCCAAGAAG
CAGGTGCGCTGTGTATACGTGGCCATCGGGCAGAAGGGAACTACCATCGCCGCGGTACGC
CGCACACTGGAAGAGGGCGGTGCGATGGACTACACCACCATCGTCGCGGCCGCGGCGTCG
GAGTCCGCCGGTTTCAAATGGCTTGCGCCGTACACCGGTTCGGCGATCGCCCAGCACTGG
ATGTACGAGGGCAAGCATGTGCTGATCATCTTCGACGACCTGACTAAGCAGGCCGAGGCA
TACCGGGCGATCTCGCTGCTGCTGCGCCGTCCGCCCGGCCGTGAGGCCTACCCCGGCGAT
GTGTTCTATCTGCATTCGCGGCTTTTGGAGCGCTGCGCCAAACTGTCCGACGATCTCGGT
GGCGGCTCGCTAACGGGTCTGCCGATCATCGAGACCAAGGCCAACGACATCTCGGCCTAC
ATCCCGACCAACGTCATCTCGATCACCGACGGGCAATGTTTCCTGGAAACCGACCTGTTC
AACCAGGGCGTCCGGCCGGCCATCAACGTCGGTGTGTCGGTGTCCCGAGTCGGCGGCGCG
GCGCAGATCAAGGCTATGAAAGAGGTCGCCGGAAGCCTCCGCTTGGACCTTTCGCAATAC
CGCGAGCTAGAAGCTTTCGCCGCTTTCGCTTCTGATTTGGACGCCGCATCGAAGGCGCAG
TTGGAGCGCGGCGCCCGGCTGGTCGAGCTGCTCAAGCAGCCGCAATCCCAGCCCATGCCC
GTTGAGGAGCAAGTGGTTTCGATCTTCCTGGGCACCGGCGGTCACCTGGACTCGGTGCCC
GTCGAGGACGTCCGGCGGTTCGAAACCGAATTACTGGACCACATGCGGGCCTCCGAAGAA
GAGATTTTGACTGAGATCCGGGACAGCCAAAAGCTCACCGAGGAGGCCGCCGACAAGCTC
ACCGAGGTCATCAAGAACTTCAAGAAGGGCTTCGCGGCCACCGGTGGCGGCTCTGTGGTG
CCCGACGAACATGTCGAGGCCCTCGACGAGGATAAGCTCGCCAAGGAAGCCGTGAAGGTC
AAAAAGCCGGCGCCGAAGAAGAAGAAATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1311	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1311	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006