Rv1311 - ATP synthase epsilon chain atpC

Expression: Most Significant Conditions for Rv1311

Protein Domains

Gene Information
Locus	Rv1311
Symbol	atpC
Gene Name	ATP synthase epsilon chain atpC
Location	1467315 - 1467680 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:366 bp Protein:122 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	519
Related Genes	Acel_0654 BL0356 CE1316 cg1369 DIP1053 jk1334 MAP2450c MAV_1528 Mkms_3949 ML1146 Mmcs_3875 MSMEG_4935 MT1351 MUL_3953 Mvan_4327 nfa10660 PPA1238 SAV2880
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1311
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1311 Transcript 1
MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKD
LRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAI
D*

Genomic Sequence

>Rv1311
ATGGCCGAATTGAACGTTGAGATCGTCGCCGTCGACCGGAACATCTGGTCGGGTACGGCG
AAGTTTCTGTTCACCCGCACCACCGTCGGTGAGATCGGCATCCTGCCCCGCCACATTCCG
TTGGTGGCCCAATTGGTCGATGACGCCATGGTGCGGGTCGAGCGGGAGGGAGAAAAGGAC
CTGAGGATCGCGGTCGACGGCGGGTTCCTGTCGGTGACCGAGGAGGGCGTCAGCATTCTC
GCCGAATCTGCCGAGTTCGAGTCGGAGATCGACGAGGCCGCCGCCAAGCAGGATTCCGAA
TCCGACGATCCCCGCATCGCTGCCAGGGGCCGCGCCAGATTGCGCGCCGTCGGCGCGATC
GACTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Operon (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Operon (Functional linkage) E. Huitric, P. Verhasselt et al. Rates and mechanisms of resistance development in Mycobacterium tuberculosis to a novel diarylquinoline ATP synthase inhibitor. Antimicrob. Agents Chemother. 2010
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1310	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1309	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1308	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Koul,L. Vranckx,N. Dendouga,W. Balemans,I. Van den Wyngaert,K. Vergauwen,HW. Göhlmann,R. Willebrords,A. Poncelet,J. Guillemont,D. Bald,K. Andries Diarylquinolines are bactericidal for dormant mycobacteria as a result of disturbed ATP homeostasis. J. Biol. Chem. 2008
Interaction	PhysicalInteraction Rv1307	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,R. Wang,JT. Prince,EM. Marcotte Mass spectrometry of the M. smegmatis proteome: protein expression levels correlate with function, operons, and codon bias. Genome Res. 2005