Rv1316c - methylated-DNA-protein-cysteine methyltransferase ogt

Expression: Most Significant Conditions for Rv1316c

Protein Domains

Gene Information
Locus	Rv1316c
Symbol	ogt
Gene Name	methylated-DNA-protein-cysteine methyltransferase ogt
Location	1477134 - 1477631 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:498 bp Protein:166 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33464
Related Genes	CE2837 cg3331 DIP1487 jk0188 MAP2445 MAV_1536 Mkms_3945 ML1151 Mmcs_3871 MSMEG_4928 MT1357 MUL_3946 Mvan_4323 nfa53680 SAV1933
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1316c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1316c Transcript 1
MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAG
ELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPI
AIIVPCHRVIGASGKLTGYGGGINRKRALLELEKSRAPADLTLFD*

Genomic Sequence

>Rv1316c
ATGATTCACTACCGCACCATCGATAGCCCCATCGGGCCATTAACCCTGGCCGGGCATGGC
TCGGTGTTGACGAACCTGCGGATGCTCGAGCAGACGTATGAGCCAAGCCGCACACACTGG
ACACCCGACCCCGGCGCATTTTCTGGCGCTGTCGACCAACTCAACGCTTATTTCGCCGGC
GAGCTCACCGAATTCGATGTGGAACTTGACCTCCGGGGAACCGACTTTCAGCAACGAGTA
TGGAAAGCATTGCTGACAATCCCGTACGGGGAAACCCGGTCCTACGGGGAAATCGCCGAC
CAGATCGGCGCCCCCGGCGCCGCACGCGCCGTGGGATTGGCCAACGGCCACAATCCCATC
GCCATCATCGTCCCGTGCCACCGCGTGATCGGCGCCAGCGGAAAGCTCACCGGGTACGGC
GGTGGAATCAACCGGAAACGAGCTCTGCTCGAGTTGGAGAAAAGCCGGGCGCCCGCAGAC
TTGACGCTCTTCGACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulates Rv1317c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1316c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1316c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0672	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1317c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv1316c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1316c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0672	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Other	TBPWY:Direct reversal	active	vmizrahi	2012-03-05
	Deletion mutant lacking Rv1317c-Rv1316c alkylation damage repair and reversal operon is hypersensitive to genotoxic effects of MNNG but showed no phenotype in vivo