Rv1343c - lipoprotein lprD

Expression: Most Significant Conditions for Rv1343c

Protein Domains

Gene Information
Locus	Rv1343c
Symbol	lprD
Gene Name	lipoprotein lprD
Location	1508543 - 1508923 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:381 bp Protein:127 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	985
Related Genes	Acel_0055 CE2398 cg2748 DIP1848 jk0502 MAP2418 MAV_1560 Mkms_3914 ML1177 Mmcs_3840 MSMEG_4898 MT1384 MUL_3904 Mvan_4283 nfa10980
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1343c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1343c Transcript 1
MSTTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWPLFAWFCVYAY
RNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDDPVLREYNAYLAELAKDDARK
QNRTTA*

Genomic Sequence

>Rv1343c
GTGTCCACTACCCGCCGTCGCAGACCCGCGCTGATCGCGTTGGTGATCATCGCGACCTGT
GGTTGCCTGGCCCTGGGTTGGTGGCAGTGGACCAGGTTTCAATCGACCTCGGGCACCTTT
CAAAATCTGGGTTACGCGTTGCAGTGGCCATTGTTTGCTTGGTTCTGCGTCTACGCGTAC
CGCAACTTCGTTCGGTATGAAGAGACGCCCCCGCAACCGCCCACCGGCGGCGCCGCCGCC
GAGATACCTGCCGGATTGCTGCCCGAGCGGCCGAAGCCGGCGCAGCAGCCACCCGACGAT
CCCGTACTACGGGAATACAACGCCTACCTAGCCGAGCTAGCCAAGGACGATGCCAGGAAG
CAGAACAGGACCACCGCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1343c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1343c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv1343c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1343c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006