Rv1365c - anti-anti-sigma factor rsfA

Expression: Most Significant Conditions for Rv1365c

Protein Domains

Gene Information
Locus	Rv1365c
Symbol	rsfA
Gene Name	anti-anti-sigma factor rsfA
Location	1537783 - 1538169 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:387 bp Protein:129 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12953
Related Genes	MT1411 nfa27080
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1365c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1365c Transcript 1
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEP
LVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPT
TESALSAT*

Genomic Sequence

>Rv1365c
ATGAACCCGACTCAGGCAGGGTCATTCACTACTCCGGTGAGCAACGCGCTCAAGGCGACC
ATCCAGCACCACGACTCGGCTGTGATTATCCATGCGCGTGGCGAGATCGACGCCGCCAAT
GAGCACACTTGGCAAGATCTGGTCACGAAGGCGGCCGCGGCCACCACCGCGCCGGAACCA
CTCGTGGTCAACCTCAACGGCCTCGATTTCATGGGCTGCTGCGCAGTCGCCGTCCTTGCT
CACGAGGCCGAACGGTGTCGACGCCGGGGCGTGGACGTGCGCCTGGTAAGCCGCGACCGT
GCTGTCGCGCGCATCATCCACGCCTGCGGATACGGCGACGTGCTGCCCGTACACCCGACC
ACGGAGTCCGCGCTGTCAGCGACATAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Structural Analysis authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric S. Rodrigue,R. Provvedi,PE. Jacques,L. Gaudreau,R. Manganelli The sigma factors of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2006
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric J. DeMaio, Y. Zhang et al. Mycobacterium tuberculosis sigF is part of a gene cluster with similarities to the Bacillus subtilis sigF and sigB operons. Tuber. Lung Dis. 1997
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric P. Sachdeva, A. Narayan et al. Loss of kinase activity in Mycobacterium tuberculosis multidomain protein Rv1364c. FEBS J. 2008
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Inhibits Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	InhibitedBy Rv3287c	active	vijayachitra	2012-10-05
	Spectrophotometric authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) authors,J. Beaucher,S. Rodrigue,PE. Jacques,I. Smith,R. Brzezinski,L. Gaudreau Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms. Mol. Microbiol. 2002
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Regulatory Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Transcription Rv3286c	active	hibeeluck	2012-10-05
	Co-expression (Functional linkage) S. Dhandayuthapani Stress response of genes encoding putative stress signaling molecules of Mycobacterium tuberculosis. Front. Biosci. 2007
Interaction	Regulatory Rv1904	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3287c	active	prabhakarsmail	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv3287c	active	akankshajain.21	2012-10-05
	Yeast two-hybrid (Physical interaction) BK. Parida, T. Douglas et al. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinburgh, Scotland) null