Rv1395 - transcriptional regulator

Expression: Most Significant Conditions for Rv1395

Protein Domains

Gene Information
Locus	Rv1395
Symbol
Gene Name	transcriptional regulator
Location	1571047 - 1572081 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1035 bp Protein:345 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13434
Related Genes	Mkms_3278 Mmcs_3216 MT1440
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1395
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1395 Transcript 1
MGHLPPPAEVRHPVYATRVLCEVANERGVPTADVLAGTAIEPADLDDPDAVVGALDEITA
VRRLLARLPDDAGIGIDVGSRFALTHFGLFGFAVMSCGTLRELLTIAMRYFALTTMHVDI
TLFETADDCLVELDASHLPADVRGFFIERDIAGIIATTTSFALPLAAKYADQVSAELAVD
AELLRPLLELVPVHDVAFGRAHNRVHFPRAMFDEPLPQADRHTLEMCIAQCDVLMQRNER
RRGITALVRSKLFRDSGLFPTFTDVAGELDMHPRTLRRRLAEEGTSFRALLGEARSTVAV
DLLRNVGLTVQQVSTRLGYTEVSTFSHAFKRWYGVAPSEYSRRG*

Genomic Sequence

>Rv1395
GTGGGACATCTACCGCCTCCGGCCGAGGTGAGGCATCCGGTGTATGCGACCCGGGTGCTG
TGTGAGGTGGCCAACGAGCGCGGGGTGCCGACCGCTGATGTGCTGGCGGGCACGGCGATC
GAGCCGGCCGACCTCGACGATCCGGACGCGGTGGTCGGTGCGCTTGACGAGATCACCGCG
GTGCGCCGGTTGCTGGCCCGATTGCCCGACGACGCCGGTATCGGGATCGACGTAGGCAGC
CGGTTCGCGCTCACCCACTTCGGGTTGTTCGGGTTTGCCGTGATGTCATGTGGCACCCTT
CGCGAACTGCTTACCATCGCGATGCGCTATTTCGCGTTGACCACCATGCACGTCGACATC
ACGTTGTTTGAAACCGCCGACGATTGCCTGGTCGAACTGGATGCCAGCCACTTGCCGGCC
GATGTCCGTGGATTCTTCATCGAGCGCGATATTGCCGGAATCATCGCGACGACAACGAGT
TTCGCGCTTCCGTTAGCCGCGAAGTATGCGGATCAAGTATCGGCCGAACTGGCGGTTGAC
GCGGAATTGTTGCGCCCGTTGCTCGAGCTTGTGCCGGTGCACGACGTCGCATTCGGGCGC
GCGCACAACCGGGTGCACTTCCCGCGTGCCATGTTCGACGAGCCGTTGCCGCAGGCCGAC
CGCCATACGTTGGAAATGTGTATTGCACAATGCGACGTGCTGATGCAACGCAACGAGCGA
CGCCGTGGCATCACGGCCTTGGTGCGCAGCAAGCTGTTTCGCGATTCCGGGCTTTTCCCA
ACGTTTACCGACGTTGCTGGCGAACTTGACATGCATCCGCGGACGCTGCGGCGTCGACTT
GCCGAGGAAGGCACTTCGTTTCGGGCCTTGCTGGGCGAGGCGCGCTCCACCGTGGCCGTC
GACCTGCTACGCAACGTCGGGCTGACGGTGCAGCAGGTGTCCACCCGGCTGGGCTACACC
GAAGTCTCGACGTTCTCGCATGCGTTCAAACGCTGGTATGGCGTTGCGCCCAGCGAATAT
TCGCGCCGCGGGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2781c	active	sumaavasthi	2012-10-05
	C. Recchi, B. Sclavi et al. Mycobacterium tuberculosis Rv1395 is a class III transcriptional regulator of the AraC family involved in cytochrome P450 regulation. J. Biol. Chem. 2003
Interaction	Regulatory Rv1394c	active	styleankit01	2012-10-05
	bandshift C. Recchi, B. Sclavi et al. Mycobacterium tuberculosis Rv1395 is a class III transcriptional regulator of the AraC family involved in cytochrome P450 regulation. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv1394c	active	sourish10	2012-10-05
	Band Shift C. Recchi, B. Sclavi et al. Mycobacterium tuberculosis Rv1395 is a class III transcriptional regulator of the AraC family involved in cytochrome P450 regulation. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv1394c	active	ahal4789	2012-10-05
	Band Shift C. Recchi, B. Sclavi et al. Mycobacterium tuberculosis Rv1395 is a class III transcriptional regulator of the AraC family involved in cytochrome P450 regulation. J. Biol. Chem. 2003
Interaction	RegulatedBy Rv1395	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1395	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3817	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3816c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3482c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3408	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2908c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2781c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2728c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2322c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2198c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2178c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1511	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1394c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1263	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1262c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1253	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1251c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0667	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0470c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008