Rv1459c - conserved membrane protein

Expression: Most Significant Conditions for Rv1459c

Protein Domains

Gene Information
Locus	Rv1459c
Symbol
Gene Name	conserved membrane protein
Location	1644363 - 1646138 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1776 bp Protein:592 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28626
Related Genes	CE1688 cg1766 DIP1297 jk0986 MAP1185c MAV_3320 Mkms_2479 ML0591 Mmcs_2434 MSMEG_3120 MT1506 MUL_1860 Mvan_2731 nfa35640 SAV1313
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1459c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1459c Transcript 1
MAARHHTLSWSIASLHGDEQAVGAPLTTTELTALARTRLFGATGTVLMAIGALGAGARPV
VQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWLMLGRFTLGRRRMSRGKLDRTLLL
WMLPLLIAPPMYSKDVYSYLAQSEIGRDGLDPYRVGPASGLGLGHVFTLSVPSLWRETPA
PYGPLFLWIGRGISSLTGENIVAAVLCHRLVVLIGVTLIVWATPRLAQRCGVAEVSALWL
GAANPLLIMHLVAGIHNEALMLGLMLTGVEFALRGLDMANTPRPSPETWRLGPATIRASR
RPELGASPRAGASRAVKPRPEWGPLAMLLAGSILITLSSQVKLPSLLAMGFVTTVLAYRW
GGNLRALLLAAAVMASLTLAIMAILGWASGLGFGWINTLGTANVVRSWMSPPTLLALGTG
HVGILLGLGDHTTAVLSLTRAIGVLIITVMVCWLLLAVLRGRLHPIGGLGVALAVTVLLF
PVVQPWYLLWAIIPLAAWATRPGFRVAAILATLIVGIFGPTANGDRFALFQIVDATAASA
IIVILLIALTYTRLPWRPLAAEQVVTAAESASKTPATRRPTAAPDAYADST*

Genomic Sequence

>Rv1459c
ATGGCAGCCCGCCACCATACGCTGAGCTGGTCGATCGCCAGCCTGCATGGCGACGAGCAG
GCGGTGGGTGCACCGCTGACCACTACCGAGCTCACCGCGCTGGCGCGCACCCGCCTGTTT
GGGGCCACCGGCACCGTCCTGATGGCCATCGGCGCCCTGGGCGCCGGGGCCCGACCCGTC
GTCCAGGACCCCACCTTCGGGGTCCGGCTGCTCAATCTGCCGTCACGAATCCAAACGGTG
TCGTTGACCATGACCACGACCGGGGCGGTCATGATGGCGCTGGCCTGGCTGATGCTCGGC
CGGTTCACGCTGGGCAGGCGGCGGATGTCGCGCGGCAAACTGGACCGCACCCTGCTGCTC
TGGATGCTGCCGCTATTGATCGCACCACCGATGTACAGCAAGGATGTCTACTCATATCTA
GCCCAAAGTGAGATCGGCAGGGACGGACTCGACCCTTACCGGGTGGGTCCGGCGTCCGGC
TTGGGCCTCGGCCACGTGTTCACCCTGTCGGTGCCCAGCCTGTGGCGGGAGACACCGGCG
CCATATGGTCCGCTGTTCTTGTGGATCGGCCGCGGAATCTCGTCGCTGACTGGGGAAAAC
ATCGTCGCTGCCGTGCTCTGCCACCGGCTTGTGGTGTTGATCGGTGTGACCCTGATCGTG
TGGGCGACCCCTCGGCTAGCTCAGCGCTGTGGCGTCGCCGAGGTCAGCGCGCTGTGGCTA
GGCGCGGCCAATCCGCTGCTGATCATGCATTTGGTCGCCGGCATCCACAACGAAGCGCTG
ATGCTCGGGCTGATGCTGACCGGCGTCGAATTCGCGCTGCGCGGCCTTGATATGGCGAAT
ACCCCACGCCCGTCGCCCGAAACCTGGCGGTTGGGCCCCGCCACAATACGGGCCAGCCGG
CGGCCCGAGCTGGGGGCATCCCCGCGTGCGGGCGCGAGCCGGGCAGTCAAACCCCGTCCG
GAATGGGGGCCCCTGGCCATGCTGCTGGCGGGTTCCATCCTGATCACGCTGTCGTCGCAA
GTGAAGCTACCCTCGCTGCTGGCGATGGGCTTCGTCACGACAGTGCTGGCATACCGCTGG
GGTGGCAACTTGCGAGCACTGCTGCTCGCCGCCGCTGTGATGGCGAGTCTAACGCTGGCG
ATAATGGCCATCCTGGGTTGGGCCAGCGGTCTCGGATTCGGCTGGATCAACACGCTGGGC
ACCGCCAATGTGGTGCGCAGCTGGATGTCGCCGCCGACACTGCTGGCCCTGGGCACCGGG
CACGTCGGCATCCTGCTGGGCCTGGGTGATCACACCACCGCCGTGTTGTCACTCACCCGC
GCCATCGGCGTGCTGATCATCACGGTGATGGTGTGCTGGCTGTTATTGGCCGTGCTCCGC
GGCCGGCTGCACCCGATCGGCGGCCTGGGCGTTGCGCTAGCTGTCACCGTGCTGCTGTTT
CCCGTCGTGCAGCCCTGGTACCTGCTGTGGGCGATAATTCCGCTGGCCGCCTGGGCAACC
CGCCCGGGATTTCGGGTAGCGGCAATCCTGGCCACCCTCATCGTCGGAATTTTCGGTCCG
ACCGCCAATGGTGACCGCTTCGCGCTGTTTCAGATCGTGGATGCGACCGCGGCCAGCGCC
ATCATCGTGATCCTCCTGATTGCCCTGACCTACACCCGGTTACCATGGCGGCCACTTGCA
GCCGAGCAAGTGGTCACCGCCGCGGAGTCGGCCAGCAAGACCCCTGCGACCCGCCGGCCG
ACGGCAGCGCCCGACGCCTACGCTGATTCCACGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1456c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1456c	active	jgalag	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	jgalag	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	jgalag	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,D. Kaur,ME. Guerin,H. Skovierová,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1456c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009