Rv1466 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1466

Protein Domains

Gene Information
Locus	Rv1466
Symbol
Gene Name	conserved hypothetical protein
Location	1653231 - 1653578 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:348 bp Protein:116 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32874
Related Genes	Acel_1140 BL0867 CE1681 cg1759 DIP1290 jk0979 MAP1192 MAV_3313 Mkms_2486 ML0598 Mmcs_2441 MSMEG_3127 MT1513 MUL_1867 Mvan_2738 nfa35550 PPA1543 SAV6331
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1466
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1466 Transcript 1
MSETSAPAEELLADVEEAMRDVVDPELGINVVDLGLVYGLDVQDGDEGTVALIDMTLTSA
ACPLTDVIEDQSRSALVGSGLVDDIRINWVWNPPWGPDKITEDGREQLRALGFTV*

Genomic Sequence

>Rv1466
ATGAGCGAAACCAGCGCACCGGCTGAGGAATTGCTCGCCGACGTCGAGGAGGCGATGCGC
GACGTCGTCGACCCGGAGCTGGGGATCAACGTCGTTGACCTGGGCCTGGTCTACGGCTTG
GACGTGCAAGACGGTGACGAAGGGACCGTCGCGCTGATCGACATGACCCTCACGTCGGCG
GCGTGCCCGCTGACCGATGTCATCGAGGATCAGTCGCGCAGCGCGCTGGTCGGCAGTGGC
CTGGTCGACGACATCCGCATCAACTGGGTGTGGAACCCGCCGTGGGGCCCGGACAAGATC
ACCGAAGACGGCCGCGAACAATTGCGGGCGCTCGGCTTCACCGTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv3557c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1931c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0818	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0260c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009